SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52345456|ref|NP_001004776| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52345456|ref|NP_001004776|
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 6.22e-45
Family Calmodulin-like 0.000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|52345456|ref|NP_001004776|
Sequence length 161
Comment troponin C type 1 (slow) [Xenopus (Silurana) tropicalis]
Sequence
MDDIYKAAVEQLTEEQKNEFRAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMM
LEATGETITEDDIEELMRDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences O12998 Q6DK95
NP_001004776.1.99540 NP_001083764.1.7800 gi|49522032|gb|AAH74504| gi|52345456|ref|NP_001004776| gi|89271380|gb|CAJ83185| gi|148223295|ref|NP_001083764| gi|1945537|gb|BAA19736| gi|52430470|gb|AAH82829|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]