SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52345560|ref|NP_001004828| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52345560|ref|NP_001004828|
Domain Number 1 Region: 52-145
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 3.27e-28
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00019
Further Details:      
 
Domain Number 2 Region: 130-240
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-23
Family UBX domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|52345560|ref|NP_001004828|
Sequence length 252
Comment UBX domain protein 2A [Xenopus (Silurana) tropicalis]
Sequence
MREADKLDNMKSQDRGFRSGGRGSERKRCDSFVNSLFEEAENAGAFIASPEDEDSNADVI
IKMWKNGFTINDGYLRDYSGAENRQFMDSVRKGELPEELQKTFDKEEIAVNVEDRKNEEY
LLRKPNIDAFSGLGHRLGSAAPKVITKDMETCNEQSLPSVDLNELEPLTNIKVWLADGKR
IVQKFNTSHRISDVRDFLERIPCKPGNAPFTLATSFPLHDLLDESLTIQEAELQNSVLVQ
KLQRTTEPFRNS
Download sequence
Identical sequences Q6GL86
gi|49257816|gb|AAH74618| gi|52345560|ref|NP_001004828| NP_001004828.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]