SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52345586|ref|NP_001004841| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52345586|ref|NP_001004841|
Domain Number 1 Region: 120-375
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-67
Family Nuclear receptor ligand-binding domain 0.00000849
Further Details:      
 
Domain Number 2 Region: 52-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-30
Family Nuclear receptor 0.0000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|52345586|ref|NP_001004841|
Sequence length 389
Comment nuclear receptor subfamily 2, group F, member 6 [Xenopus (Silurana) tropicalis]
Sequence
MAMVSGGWGDPNGDTNGVGKGYPRNSEEEEASPQGGMSDPEQGDEERPGIQVDCVVCGDK
SSGKHYGVFTCEGCKSFFKRSVRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMR
KEAVQRGRIPPAHSSASPTSAPGAGEYFNGQPVSELISQLLRAEPYPASRYGSQYAQQGS
VMGIDNICELAARLLFSTVEWSRNIPYFPELAMADQVSLLRLSWSELFVLSAAQSALPLH
MAPLLAAAGFHASPMSADRVVSFMDQIRLFQDQVEKLNRLQVDSAEYACLKAIALFTSDA
CGLTDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMR
LVGKTPIETLIRDMLLSGSSFNWPYSSGQ
Download sequence
Identical sequences Q6GL59
NP_001004841.1.99540 XP_012814493.1.99540 XP_017947447.1.99540 gi|49250456|gb|AAH74651| gi|52345586|ref|NP_001004841| ENSXETP00000029647 ENSXETP00000029647 8364.ENSXETP00000029647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]