SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54020888|ref|NP_001005687| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54020888|ref|NP_001005687|
Domain Number 1 Region: 81-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-30
Family RecA protein-like (ATPase-domain) 0.00056
Further Details:      
 
Weak hits

Sequence:  gi|54020888|ref|NP_001005687|
Domain Number - Region: 11-59
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.00102
Family C-terminal domain of RNA polymerase alpha subunit 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54020888|ref|NP_001005687|
Sequence length 320
Comment RAD51 homolog D [Xenopus (Silurana) tropicalis]
Sequence
MVILREGLCPGLSAGIVAVLKANNVKTVIDLVASDLEELARKCSLSYKTLMAVRRVLLAQ
YSAFPSSGADVYEELKSSTAILPTGNRKLDILLDSGLYTGEVTEIAGAAGSGKTQTCQSI
AVNVAYNLKQTVLYVDTTGGLTASRLLQLVQSRTKSEDEQVASLQRIEVIRVFDIYKLFD
AFQDLRHQISQQLLRSGEPLRLVIVDSVCAVIYPMLGGKHTEGMAIMMQLARELQTLAHD
YHLAILISNSITKDGATGNRPALGRSWSFVPSTRILLTPTELNCGHSIVSLVKSPRQPTN
LQLDMEIGICGTLEENNLSS
Download sequence
Identical sequences Q6DJR4
8364.ENSXETP00000019650 NP_001005687.1.99540 gi|49522896|gb|AAH75110| gi|54020888|ref|NP_001005687| gi|89273792|gb|CAJ83738| ENSXETP00000019650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]