SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54038250|gb|AAH84495| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54038250|gb|AAH84495|
Domain Number 1 Region: 112-126,249-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-66
Family Nuclear receptor ligand-binding domain 0.00000000453
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-30
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54038250|gb|AAH84495|
Sequence length 501
Comment nuclear receptor subfamily 5, group A, member 2 [Xenopus (Silurana) tropicalis]
Sequence
MLPKVEPEALGLSRSHGEQGHMPENMQASQFKMMGYSYDEELEEMCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQSCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADR
MRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMGQVIQSIPTDLTISSAIQNIHSAS
KGLPLNHAALPPSDYDRSPFVTSPISMAMPPHGSLQGYQAYGHFPSRAIKSEYPDPYTSS
PESIMGYSYMDSYQSSSPSNIPHLIVELLKCEPDEPQVQGKIMAYLQQEQANRSKHDKLN
TFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIFRQVLHGKE
GSILLVTGQQVDYSVIVTQAGATLNNLMSHAQDLVAKLRSLQFDLREFVCLKFLVLFSLD
VKNLENYQLVEGVQEQINAALLDYTMCNYPQQTDKFGQLLLRLPEIRAISLQAEEYLYYK
HLNGDVPCNNLLIEMLHAKRA
Download sequence
Identical sequences Q5XGE7
8364.ENSXETP00000000645 NP_001011100.1.99540 gi|54038250|gb|AAH84495| gi|58331857|ref|NP_001011100|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]