SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55741970|ref|NP_001006802| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55741970|ref|NP_001006802|
Domain Number 1 Region: 52-180
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.29e-56
Family N-terminal domain of cbl (N-cbl) 0.00000135
Further Details:      
 
Domain Number 2 Region: 267-353
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-48
Family SH2 domain 0.000004
Further Details:      
 
Domain Number 3 Region: 360-437
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-42
Family RING finger domain, C3HC4 0.0000104
Further Details:      
 
Domain Number 4 Region: 182-266
Classification Level Classification E-value
Superfamily EF-hand 7.48e-37
Family EF-hand modules in multidomain proteins 0.0000104
Further Details:      
 
Domain Number 5 Region: 929-969
Classification Level Classification E-value
Superfamily UBA-like 0.0000306
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55741970|ref|NP_001006802|
Sequence length 982
Comment E3 ubiquitin-protein ligase CBL-B [Xenopus (Silurana) tropicalis]
Sequence
MASSSSSSSSTNSSAVTGRLPGARSANPRKARILGLFDAIQDAVGPPKQAAADRRTVEKT
WKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKI
YIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGD
NFRITKADAAEFWRKFFGERTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYIS
VFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSC
TRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTP
HDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESDGQGCP
FCRCEIKGTEPIVVDPFDPRDENRCCSFNDSLCTPMLDFDDDDLREECLIMNRLASLRKM
NERQNSPVTSPGSSPLSQRRKTPPDPLQIPHLNLPPVPPRLDLIQKGLARSPCASPTGSP
KSSPCMVRKQDKPLPAPPPPLREPPPPPERPPPIPPDSRTCRHLHHTENVPCRDQSTQHD
AWCTRDISGASQPSICRVAHDGSPKLGVPSSSVLNGRHSRMSTEAGFIRHKHHKRRESPL
ETIRVYNGLSGNEEYDVPPRLSPPPPPPTITIHPAIKCPLLVNSVSDKVRNSAEEDDSEY
KIPSSHPVSSRLPLHCHSIKHFPRLCENGQCLSNGTHNGISEIKKLKQPDQGDVIATSTV
PVPLPSARTSARENHPHGSSLTRTPSDYDLLVPHPGEESFDSSPPSQPPPPPPARTCVPE
HAMPTASGCRPNSDVDLFLPHSDPCPEAPLPPARRGPGEAKSNRLSQEYDQLPSCPDCPQ
APARPPKPVPRRTAPEIHHRRHYNCDSLAENVDAKIAKLMGEGFPFEEVKRALEIAQNNV
DVARSILREFAFPPPVCPRLHL
Download sequence
Identical sequences Q6DFR2
NP_001006802.1.99540 gi|49903336|gb|AAH76671| gi|55741970|ref|NP_001006802| gi|82182944|sp|Q6DFR2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]