SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55742047|ref|NP_001006765| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55742047|ref|NP_001006765|
Domain Number 1 Region: 603-904
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-80
Family Protein kinases, catalytic subunit 0.000000000538
Further Details:      
 
Domain Number 2 Region: 25-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.85e-67
Family Ephrin receptor ligand binding domain 0.000007
Further Details:      
 
Domain Number 3 Region: 324-524
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-29
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 901-969
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.22e-16
Family SAM (sterile alpha motif) domain 0.0026
Further Details:      
 
Domain Number 5 Region: 224-317,362-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000179
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55742047|ref|NP_001006765|
Sequence length 974
Comment EPH receptor A2 precursor [Xenopus (Silurana) tropicalis]
Sequence
MRPERIVPVLTLLLSNVFIALQTKEVVLLDFEKTQGELGWLTHPYGKGWDLLQNVMNGSM
IYIYSVCNVQEGEQDNWLRTNWIYRSEAQRIFVELKFTVRDCNSFPGGSGTCKETFNLYS
LESDIDYGTNFQKRQFRKIDTIAPDEITVQADFASRNVKVNVEVRSVGPLSRKGFYLAFQ
DIGACVALLSVRIYYKKCPSVVQGMAQFPETVAGTDSQSLAKVSGQCVNNAVSATGEVPT
MHCNTDGEWLVPIGHCLCQPGYEKVGDTCQACKPGFFKSETSNGPCLPCPDHTEPTSQAA
TFCPCNDGFFRATSDSNSAPCTSFPSAPRDFTAVDMGSKVVLRWLPPSNSGGRSDITYTV
TCEKCPPETGDCVPCDNIRYSETPRDLKGTTISIMDLEPHLNYSFTVEARNGVSASGSSR
SYAALRISLNQTEPPKVTSVILENQGTNSLGLSWSVPARQQSRVWKYEVTYSKKHDGNSY
SVQRCEGNAVTLVKLAPGTTYVVRVQTLTQEGVGIYSKDYEFDTLLGEENSNNAAVIGGA
IAGSLLIVVFVAVIIFMHRSRRNPNTRQSDEDIYFSKPEQLKPLKTYVDPHTYEDPNKAV
LKFTTEISPNSITRQKVIGAGEFGEVFKGILKLPGKKEVPVAIKTLKAGYTEKQRIDFLS
EASIMGQFCHHNIIRLEGVVSRYKPMMIVTEHMENGALDKFLKDNDGEFCPIQLVGMLRG
IAAGMKYLSEMNYVHRDLAARNILVNSQLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIR
WTAPEAISYRKFTSASDVWSYGIVMWEVMSYGERPYWEMSNQEVMKAINEGFRLPAPMDC
PSAIYQLMMQCWQQERNRRPKFPDIVSILDKLIRAPDSLKTLADFDPRISIRLPSTSGSE
GMPFRTIAEWLESIKMQQYNEFFMASPYNSMDKIILMNQDDIKHLGIRQTGHQKRIAFSI
LGLKEHASTMGIPI
Download sequence
Identical sequences Q6DII4
gi|49522498|gb|AAH75556| gi|55742047|ref|NP_001006765| NP_001006765.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]