SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56789424|gb|AAH88051| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56789424|gb|AAH88051|
Domain Number 1 Region: 10-59
Classification Level Classification E-value
Superfamily L domain-like 0.0000085
Family Ngr ectodomain-like 0.054
Further Details:      
 
Weak hits

Sequence:  gi|56789424|gb|AAH88051|
Domain Number - Region: 92-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0062
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56789424|gb|AAH88051|
Sequence length 164
Comment RIKEN cDNA 0610007C21 gene [Xenopus tropicalis]
Sequence
MDGSDVIIGLDLWNCSLAQLDPTLHLTQAAVVLDLSSNPLRDLPSEFFRGLLGLQYVALP
AELSCPGGNNSWENVNVTSAVRVCQDQRSSCNSTSEWVLCPENSVCAPDGPGYMQCVCAP
GFHGYKCLRESTFPILMFFGILGLVTACLSVLLWCTQRRKVKSQ
Download sequence
Identical sequences Q5M8F4
NP_001011316.1.99540 gi|56789424|gb|AAH88051| gi|58332482|ref|NP_001011316|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]