SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58332288|ref|NP_001011293| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58332288|ref|NP_001011293|
Domain Number 1 Region: 17-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-71
Family Eukaryotic proteases 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58332288|ref|NP_001011293|
Sequence length 248
Comment uncharacterized protein LOC496746 precursor [Xenopus (Silurana) tropicalis]
Sequence
MPIWVLLFLGVVAASPLVDDKIIGEYECAPHSQKWQVYFTYKGYPWCGGSLISSRWIISA
ASCNQSPKYLIAHLGKHDITREEGTEQHIQVEKTFPHNRYLGLSDSNNIMLVKLAEPAQF
NQFVQPIKVASSCPREGKVCQVSGFGNLNSYAEKYPDRLQCLDLPILPESSCDAYFSPKK
MHTNLMCAGFAQDDKDSCQGDAGGPLICKGELYGIILWGNECSGRGIPGVYLKVCNFTNW
MQNIINNN
Download sequence
Identical sequences Q5M8I3
NP_001011293.1.99540 gi|56789072|gb|AAH88011| gi|58332288|ref|NP_001011293|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]