SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58332648|ref|NP_001011400| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|58332648|ref|NP_001011400|
Domain Number - Region: 37-64
Classification Level Classification E-value
Superfamily Plexin repeat 0.0157
Family Plexin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58332648|ref|NP_001011400|
Sequence length 183
Comment pituitary tumor-transforming 1 interacting protein, gene 2 precursor [Xenopus (Silurana) tropicalis]
Sequence
MGKWAELPGTVALLLMLSLGMAGGSYTSAPVPPVTAACSFYSGRSCEECLKNVSCFWCIT
NNTCLDYPVRNILPPSSLCAMSAARWGACWINFEALIITISVVLGLILLSTTVCCCYCCY
CRKRSNSLMRLEAEEENLMRERERRKQEALQRKNERTVKHNEIRKKYGLLQDMDHPYSRY
ENE
Download sequence
Identical sequences Q5M7J6
8364.ENSXETP00000007508 gi|56789649|gb|AAH88608| gi|58332648|ref|NP_001011400| NP_001011400.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]