SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58476348|gb|AAH89679| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58476348|gb|AAH89679|
Domain Number 1 Region: 28-154
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-39
Family V set domains (antibody variable domain-like) 0.00028
Further Details:      
 
Domain Number 2 Region: 145-239
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-24
Family C1 set domains (antibody constant domain-like) 0.00013
Further Details:      
 
Domain Number 3 Region: 248-346
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-21
Family C1 set domains (antibody constant domain-like) 0.0027
Further Details:      
 
Domain Number 4 Region: 352-450
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-19
Family C1 set domains (antibody constant domain-like) 0.0013
Further Details:      
 
Domain Number 5 Region: 459-540
Classification Level Classification E-value
Superfamily Immunoglobulin 9.85e-18
Family C1 set domains (antibody constant domain-like) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58476348|gb|AAH89679|
Sequence length 555
Comment ighx protein [Xenopus (Silurana) tropicalis]
Sequence
LSTEITMKDIFSLLILMKLVSCVICQITLDQPGSAVVNPSGTLKLSCKVSVSVSSQHWAW
IWQAPGKGLEYIGYLHSDMRSFPAPSFQSRVTFTRDASKNEIHLQITSMKSADSGTYYCA
RGVAGYFDYWGPGTMVTVTSATQHAPSVFPLRPCCGSLGSDSHVTVGCLSSGFLPAPVTV
KWNSGAITSGIKNFPAVLQQSGSFASSSQLTIPLSDWKDKSFECNVEHAPTSTKVNKKIP
DCKDETEPSEPTVEILQGSCAAPNSIELLCLMTEYAPSEIKVQWLRNGEDASLAPSNSPP
CKEDNGTFASRSKVFVPKEDWNSGDTYTCRVTHPATRSKTDVSISKCSDTALTPKVEVLP
PTPKDLLVNREPKVYCVISKMASAEGLTVKWSRSDKKRVIAFDSPPEKEYDGTFTVKSIL
KISSGDWQPRNQFSCNIIHPDLPSPIEKSIQKDQDQGAEPIISLLPPSDDELRNDFVSLV
CVVKDFKPKEIYIFWKKDGVPIEKEYYITTTPVLEEEEDTYLAFSKLTIAKSDWIRGATF
IQSDLAMVSLLNQTG
Download sequence
Identical sequences Q5FW04
gi|58476348|gb|AAH89679|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]