SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58477071|gb|AAH89705| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58477071|gb|AAH89705|
Domain Number 1 Region: 27-81
Classification Level Classification E-value
Superfamily BPTI-like 2.84e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00073
Further Details:      
 
Domain Number 2 Region: 145-201
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 3 Region: 85-141
Classification Level Classification E-value
Superfamily BPTI-like 4.54e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|58477071|gb|AAH89705|
Sequence length 219
Comment MGC108301 protein [Xenopus (Silurana) tropicalis]
Sequence
MHASLQALMAASLLIQVFGSPMQGNTTVCLLPPDEGPCKALIPHYYYDRYTQTCQEFLYG
GCDGNSNKFLSMEDCEKFCWKIKKVPKACRMDPDEGPCRGFLKRYAYNMQTMKCEQFYYG
GCYGNDNNFKDKASCMDFCSPRRDAPSFCYSPKDEGSCSASVTRYYFNIESKACEEFVYT
GCGGNSNNFVKMEDCDSVCKKGSKRPRNRNRIRVPRIQS
Download sequence
Identical sequences Q5FVY6
NP_001015766.1.99540 8364.ENSXETP00000030406 gi|58477071|gb|AAH89705| gi|62751741|ref|NP_001015766|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]