SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60416191|gb|AAH90804| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60416191|gb|AAH90804|
Domain Number 1 Region: 96-161
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000388
Family Ovomucoid domain III-like 0.0015
Further Details:      
 
Domain Number 2 Region: 192-237
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000513
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|60416191|gb|AAH90804|
Domain Number - Region: 30-71
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00282
Family TB module/8-cys domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|60416191|gb|AAH90804|
Sequence length 255
Comment follistatin-like 3 (secreted glycoprotein) [Xenopus (Silurana) tropicalis]
Sequence
MLQFLLLPLLLCTVTRGHPIPGGDTLQSGGTCWLLQGTDSTCSRMLLSSVTWDECCKDGH
IDTAWSNYTEPMNKISLLGFLGLVSCQPCRDSCEGVQCPPGKTCFLKDGRPQCECTPDCS
GLEADVPVCGSDGHTYQDECELVTKKCRGHPDLEVMYYGKCKKSCSNVVCPGTHSCVVDQ
TGSAHCVVCRSTPCPQPLAFGNMLCGNNNVTYPSACHLRRATCYLGKSIGVRHTGSCADI
PEFSMDLDDSVKNYI
Download sequence
Identical sequences Q5CZL7
8364.ENSXETP00000049679 ENSXETP00000049679 NP_001015870.1.99540 ENSXETP00000049679 gi|60416191|gb|AAH90804| gi|62751528|ref|NP_001015870|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]