SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62751556|ref|NP_001015713| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62751556|ref|NP_001015713|
Domain Number 1 Region: 35-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000828
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 238-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000106
Family I set domains 0.047
Further Details:      
 
Domain Number 3 Region: 142-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000622
Family I set domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62751556|ref|NP_001015713|
Sequence length 349
Comment interleukin 1 receptor, type 2 precursor [Xenopus (Silurana) tropicalis]
Sequence
MRHVVVISMCVLQTMAFVVQQSGKEEKCPEQITHFMGHYVLNGEPVVIKCPAFQYLQMDL
SRVSPSSFNIAWTKNASEYLYAGRQSRIHPKKESLWFFPALIEDTGLYSCIVRNSSLCTE
LTLSLTVMKQEEVHVPDIAYEQLAFEHSQFQMFCPDLSDFTINRTDVQLQWYKDGKLLEN
DIKYMYSSGTTYMHIIDIVKNDGGYYTCKLQFTHENKEYVVSRIIHLRIVGKDKRHYPVI
QYPNHKPIAAAIGSKLLIPCKVYIGNGGNNPIVWWLANDSYIDEFFGDGRVIEGTFQERT
ESDGHYIDVSLIFENVKEEDFNTEFKCIASNDYGSQVLPTHIRRAGTVT
Download sequence
Identical sequences Q5FW36
gi|58477036|gb|AAH89644| gi|62751556|ref|NP_001015713| NP_001015713.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]