SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62751938|ref|NP_001015686| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62751938|ref|NP_001015686|
Domain Number 1 Region: 15-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.31e-83
Family Eukaryotic proteases 0.000000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62751938|ref|NP_001015686|
Sequence length 263
Comment chymotrypsin B1 [Xenopus (Silurana) tropicalis]
Sequence
MAFLWLLSCIALIGSTYGCGSPAISPVLSGYARIVNGENAVPGSWPWQVSLQDSTGFHFC
GGSVISDFWVVTAAHCGVTTAHRVILGEYDRSSPAEPIQTKTIAKVFRHPNYNSFTIAND
ITLLKLSSPASFSNIVAPVCVASSSDAFNGGERCVTTGWGYVDAASRLTPNKLQQVALPL
LSNTECQRYWGSKILNTMVCAGASGASSCMGDSGGPLVCQRNGAWVLAGIVSWGSSTCSP
SSPGVYARVSTLRSWMDQTIAAN
Download sequence
Identical sequences Q5HZD0
NP_001015686.1.99540 gi|57870463|gb|AAH89075| gi|62751938|ref|NP_001015686|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]