SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62857475|ref|NP_001016816| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62857475|ref|NP_001016816|
Domain Number 1 Region: 56-277
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-44
Family Kelch motif 0.0075
Further Details:      
 
Weak hits

Sequence:  gi|62857475|ref|NP_001016816|
Domain Number - Region: 235-352
Classification Level Classification E-value
Superfamily NHL repeat 0.0011
Family NHL repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62857475|ref|NP_001016816|
Sequence length 411
Comment kelch domain-containing protein 10 [Xenopus (Silurana) tropicalis]
Sequence
MAAEAGGGEPLVKFVKLSGRAAGSKKKVRWFPVRRLFTHSCPSLRIPSRFLREGRRSPPA
RSGHRCVADNTNLYVFGGYNPDYDESGGPENEDYPLFRELWRYHFATGMWHQMGTDGHMP
RELASMSLVLHGHNLLVFGGTGIPFGESNGNDVYVCNVKYKRWSKLNCRGKKPNRIYGQA
MAIIHGFLYVFGGTTGYIYSTDLHRLDLSTREWIQLKPNNPPCDLPEERYRHEIAHDGQR
IYVLGGGTSWTAYSLEKIHAYNFETNTWEDIPTKPYGNLGFPAARRCHSCVQIKNEVFIC
GGYNGLVILGDLWKLDLQTFQWTKLPALMPEPAYFHCAAVTPAGCMYIHGGVVNIQQNKR
TGSLFKIWLVVPSLLELCWENLLKYFPHLCQLPTHQLLQLGLSQELIERLK
Download sequence
Identical sequences Q28DE7
gi|189031483|sp|Q28DE7| gi|62857475|ref|NP_001016816| NP_001016816.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]