SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|63102077|gb|AAH95906| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|63102077|gb|AAH95906|
Domain Number 1 Region: 1535-1710
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-27
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 2 Region: 1901-2069
Classification Level Classification E-value
Superfamily Fibronectin type III 4.11e-27
Family Fibronectin type III 0.0000185
Further Details:      
 
Domain Number 3 Region: 1355-1525
Classification Level Classification E-value
Superfamily Fibronectin type III 4.31e-24
Family Fibronectin type III 0.0000363
Further Details:      
 
Domain Number 4 Region: 904-1073
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-23
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 5 Region: 719-885
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-21
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 404-459
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-20
Family Fibronectin type II module 0.0000727
Further Details:      
 
Domain Number 7 Region: 1720-1887
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 342-399
Classification Level Classification E-value
Superfamily Kringle-like 1.63e-19
Family Fibronectin type II module 0.00026
Further Details:      
 
Domain Number 9 Region: 1087-1255
Classification Level Classification E-value
Superfamily Fibronectin type III 3.92e-16
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 10 Region: 1267-1356
Classification Level Classification E-value
Superfamily Fibronectin type III 9.68e-16
Family Fibronectin type III 0.0000193
Further Details:      
 
Domain Number 11 Region: 553-598
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000877
Family Fibronectin type I module 0.0022
Further Details:      
 
Domain Number 12 Region: 2340-2383
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000759
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 468-507
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000123
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 14 Region: 91-136
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.00015
Further Details:      
 
Domain Number 15 Region: 2295-2338
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.0041
Further Details:      
 
Domain Number 16 Region: 228-272
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000406
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 17 Region: 511-555
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000563
Family Fibronectin type I module 0.006
Further Details:      
 
Domain Number 18 Region: 181-226
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000144
Family Fibronectin type I module 0.00025
Further Details:      
 
Domain Number 19 Region: 47-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000301
Family Fibronectin type I module 0.00028
Further Details:      
 
Domain Number 20 Region: 609-696
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000373
Family Fibronectin type III 0.0000118
Further Details:      
 
Domain Number 21 Region: 139-179
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000406
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 22 Region: 2383-2424
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000353
Family Fibronectin type I module 0.0027
Further Details:      
 
Domain Number 23 Region: 302-339
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000432
Family Fibronectin type I module 0.00062
Further Details:      
 
Domain Number 24 Region: 2208-2268
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000143
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|63102077|gb|AAH95906|
Sequence length 2475
Comment fibronectin 1 [Xenopus (Silurana) tropicalis]
Sequence
MRWGALTGLLLALCLCAVVRSAPSSKKRRQAQQQQVVQPHGSPDSQQKGCYDNGKYYQIN
QQWERTYLGNTLVCTCYGGGRGFNCESKPESEETCFDKYTGVTYRVGETYERPKDNMIWD
CTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPV
AERCYDNTAGISYVVGQTWEKPYQGWMMVDCTCLGEGSGRITCSSKNRCNDQDTRTSYRI
GNSWSKTDTRGNLLQCICTGNGRGEWKCDRHSSAQATGTGSNPITNIQTTLFQPDSELEP
YGHCVTDNGVLYSLGMRWLKAQGSKQMLCTCLGNGVSCEETVETITFGGNANGEPCAIPF
THDGKTYYSCTGEGRQDGKLWCATTSNYDTDKKYSFCNEQRALVQTRGGNSNGALCNFPF
LYNNRNYTDCTSEGRRDSMKWCGTTANYDADQKFGFCPMAAHEEICTTNEGVMYRVGDQW
DKQHDQGHMMRCTCVGNGRGEWTCVAYSQLKDQCIVDGITYDVNSSFTKRHEEGHMMNCT
CYGQGRGRWKCDAIDQCQDTETRQFYQIGDSWEKHLQGVRYQCYCYGKGIGEWHCQPLST
SPAGTGPVQVIITESSNFPNSHPIQWNAPQPSHIKNYILRWKPKLKTGPWKQATIPGHLN
SYTISGLKPGILYEGQLISILQYGNREVTTFDFTTTSTIHRSSQTETGETTPLPPLVATS
ESVTEITASSFLVSWVSASDTVSGFRVEYELSEDGDEKRYLELPNTATSVSIPDLLPGRR
YNVNVYQITEEGEKSLILSTTQTTAPDAPPDHNVENVDDTSILIKWTKPQAPVTGYRVVY
SPSVEGSSTELNLPSTATSVSLTELLPGIEYNITIYAVEDSLESVPIFIQQGTTGTPQTV
IVPSPTDLQLVEVTDIKITIMWNPPQSEVSGYRVVVKPVSPSDRDVQNLPVSRNTFAEVV
NLHPGRTYTFEVYAVNRGQESEPLAGDFTTKLDAPSDLQFTDVTDSTVVIIWRPPQAKIG
RYLLSVGQTRGGQPSQFHINPSATNHKLESLSPGTEYTISLVALKGNQQSASTTGVFSTL
EPVGSIPPYNTEVTETTIVVTWTPVPRIGFKLDVRPSQGGEAPREVISESGSIVISGLTP
GVEYMYSISVLKDGVERDIPITKTVVTPVAPPTNLRLQPSRDSATLTVYWDSSISPGITG
YRITTAPTPMQVGNSLEEEVGPTQTYCLFENLSPGVEYNVSVYAVKGEEESSPLSQIFLQ
EIPQLTDLKYDDVTDTSIDLRWTPLNSSTIIGYRITVVAAGESVPIYEEFVGPTDGYYKV
SGLEPGIDYEISVITLISGGESAPTTIVQHTAVPPPTNLRFTNVGPDTMRVTWSPPTSIE
LSSFLVRYSPVKKPDDVTELSLSPSTNMVVLSNLLPFTEYLVSVHSVYEERESSALNGVA
KTYLDSPTGIDFSEITPNSFTVHWIAPRAPITGYRIRYQLESGAGRPKEERVPPSRNSIT
LTHLIPGSEYIVSIIAFNGQQESLPLSGQQATVSDVPTDLEVTSSSPNTLTISWEAPSVN
VRYYRITHSQTGGHGPEKEFTVPGTSNTATIRGLNPGVSYTITVYAVTGRGDSPASSKPL
TIVHMTDVDQPTDMAVTDIQDHSIHVKWSPPPGPVTGYRVTSVPKSGQGETFSQVVSPDQ
TEVTIVGLQPAVEYVVSIYSQGENGESEPLVETAVTNIDHPKGLTFTDVGVDSIRLAWEV
PDGQVTRYRVTYSSPEEGVKELFPAPEGDDDTAELHGLRPGTEYTVSIVALHDDMESKPM
IGIQSTAIPAPTNLQFSQVTPSGFSLSWHAPTIHLSGYLVRVNPKEKTGPMKEVRLSPGV
TATTVTGLMVATKYEVNVYALKDTLTSQPLQGLISTLDNVSPPRRPRVQDVTETTVTLSW
RTKTETITGFQIDAIPAGGQNPIRRTVDADLRSFTITGLQPGTDYKIYLYTLNDNARSSP
VIVDVTTAVDSPSNLRFLTTTSNSLLFTWQPPRARITGYIIRYEKAGGLLKEHLPRLQAG
TTESTITNLEPGTEYIVYIIAVRNNQKSEPLVGRKRTDELPRLVTLPHPGKGPEILDVPT
DEENTPHITQIKLDNGNGIQLPGSNGQQPSSGNEGQLIEEHGFRSPLAPTTAVPVRPGKF
TPGHYPQERVDIELDTEFPVQRGDLDGPYPHGLGPQLNDSGVQEVASHTTISWRPELETT
EYIISCHPIEHDEAPLQFRVPGTSSSATLNGLTQGATYNIIVEAQKGSDKHKVFEKRVTV
GSPGSPEGVLQPAEDTCYDTFNGAHYSVGQEWERMSESGFRLWCKCLGYGSGHFRCDSSK
WCHDNGVNHRVGEKWDRRGENGQMMSCTCLGNGKGEFKCEPHEATCYDEGKMYNVGEQWQ
KEYLGAICSCTCYGGQQGWRCDNCRRPGAVLPDGTAGHTVSQFAQRYQQNYNLNCPIECY
LPLQADIQHSEQTQK
Download sequence
Identical sequences Q501R6
NP_001025695.1.99540 gi|63102077|gb|AAH95906| gi|71895737|ref|NP_001025695|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]