SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66396561|gb|AAH96506| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66396561|gb|AAH96506|
Domain Number 1 Region: 25-117,168-422,522-581
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.96e-34
Family LacY-like proton/sugar symporter 0.084
Further Details:      
 
Domain Number 2 Region: 437-489
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000236
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|66396561|gb|AAH96506|
Sequence length 676
Comment hypothetical protein mgc108027 [Xenopus (Silurana) tropicalis]
Sequence
MDPPEVLMSNGGGETPPQKVSCCSNLKMFLVALCFSYFAKAFSGSYMKSSITQIERRFDI
SSSTVGMIDGSFEIGNLMVIAIVSYFGAQFHRPRIIAAGCILMSLGSFLTAMPHFFMGLY
KYETVGGPTSLNSNATINVSPCLANRSLVDTPKPDCVTENGSHMWVFLLVGNILRGIGET
PIAPLGISYLDDFSRPENTPLHIACLHTVAMFGPMTGFMLGSFLARLYVDIGFVDTDTIT
ITPQDTRWVGAWWIGFLLSGAVNLMSAIPFFFLPESLKEEQREGQKPQTKQGEEKGHKQK
EKPTLRGFFAALKTLCFNRLFVMLMCLTLLQTNSFLGFITYKPKYMEQQYGQSISKANFV
TGVSTLPAAALGMFLGGLIMKRYKFGLLGASKMAYGTSLLAFLLSLSAFFIGCENNNVAG
ITVTYDRVKVNNFQDRIIYSPCNSDCHCSSKQWDPVCGENGVTYVSACLAGCKASTGSGL
GTVYHNCSCIDTALSTAVNSSAHLGSCPRGPDCSRMFMFYVVTQAINTFIFALGASSAYV
LLLWSVNPEMKSLAVGVYMLLIRTLAGIPAPIYFGAIIDKSCLKWGTRLCGGRGACRLYD
ADSFRRRFLGLTAGIRAPSYILFFIFIVMVKRRPPTGTGAPQPHEKAENCDKKELYANGA
SADECVAFQAEKETHI
Download sequence
Identical sequences Q4VA80
gi|66396561|gb|AAH96506| gi|73853824|ref|NP_001027493| NP_001027493.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]