SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66792544|gb|AAH96502| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66792544|gb|AAH96502|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Sema domain 1.7e-101
Family Sema domain 0.0000000232
Further Details:      
 
Domain Number 2 Region: 250-301
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000115
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 317-398
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000351
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|66792544|gb|AAH96502|
Sequence length 487
Comment sema3c protein [Xenopus (Silurana) tropicalis]
Sequence
RVCPNDIGGQRSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTLVYG
IFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGPNHQLIPYQGRIPYPRPGTCPGGAF
TPNMKSTKEFPDDVVTFIRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAADGK
YHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAPITSMKISSKKQQLYVSSE
EGITQLSLHRCHIYGTACADCCLARDPYCAWDGKFCSRFYPSGKRRSRRQDVKHGNPVTQ
CRGFNLKGYRNTAEIVQYGVRNNTTFLECIAKSPQASVKWLLQKDNDRRKEVKLNERIIA
TGQGLLIRSVQEVDQGLYHCIATENTFKQTIAKVNLKVLEPELVTFMTDKSQWLWASTLS
GMQFHPKDLTGAFSHSEMQIINQYCKESRQKTRQEAENQKMRGDYSKLKVLLNTRKSRNR
RNHFPGS
Download sequence
Identical sequences Q4VA84
gi|66792544|gb|AAH96502|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]