SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82801966|gb|ABB92398| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82801966|gb|ABB92398|
Domain Number 1 Region: 218-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-51
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.0002
Further Details:      
 
Domain Number 2 Region: 467-547
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000000000824
Family Blood coagulation inhibitor (disintegrin) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82801966|gb|ABB92398|
Sequence length 749
Comment disintegrin metalloproteinase [Xenopus (Silurana) tropicalis]
Sequence
MALLRLVFLLSWAACSGGHYGNPLNKYIRHYEGLNYNMDSLHQKHQRAKRAVSQEDQFVH
LDFQAHGRQFNLRMKRDTSLFSPDFKLEVGGETVDYDTSHIYTGQLFGEQGTLSHGSVVD
GRFEGFIKTHQGTFYLEPSERFFKNQAVPFHSVMYHEDDIKYPHKYGSEGGCADSSVFQR
MKEYQMSAQEESEKHDHKEDHEGSGPLILRKKRAAQAEKNTCQLYIQTDHLFYKRYGETR
EAVIAQISSHVKAIDTIYQSTDFSGIRNISFMVKRIRINVTSDEKDPTNPFRFPNIGVEK
FLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICERNKLYSDGKKKSLN
TGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGNECTPGESKNLGFKENGNFIMYA
RATSGDKLNNNKFSICSVRNISQVLDKKRNSCFVESGQPICGNGLVEQGEQCDCGYSDQC
KDDCCYDANQPENLKCTLKPGKQCSPSQGPCCNSGCTFKLRSEKCREESDCAKMGTCNGV
SAQCPPSDPRDNLTECNRATQVCIKGQCSGSICEKYDLEECTCGSSDGKDDKELCHVCCM
EKMKPHTCASTGSEAWRAHFKGKTITLQPGSPCNEFKGYCDVFMRCRLVDADGPLARLKK
AIFNPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGT
LKRRRQPQTTQQPPRQRPRESYQMGHMRR
Download sequence
Identical sequences Q2V729
gi|113205512|ref|NP_001037869| gi|82801966|gb|ABB92398| NP_001037869.1.99540 ENSXETP00000063366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]