SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89268107|gb|CAJ83850| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89268107|gb|CAJ83850|
Domain Number 1 Region: 178-443
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-80
Family Nuclear receptor ligand-binding domain 0.00000000359
Further Details:      
 
Domain Number 2 Region: 126-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-30
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89268107|gb|CAJ83850|
Sequence length 449
Comment Retinoic acid receptor RXR-beta (Retinoid X receptor beta) [Xenopus tropicalis]
Sequence
MGDSRVCQSPDTSSLSPPLGRSYSDTPPPPSAPLHPSMVGSAMTSSVNSPLGSIGSPFQV
INCSVGSPGIPGTPSIGYGPVSSPQINSTVNLSGLHPVSSSEDVKPPLGMRSMSSHPNGG
AVSGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDNKDCIVDKRQRNRC
QYCRYQKCLATGMKREAVQEERQRGKERDGEAEFSGAINEEMPVEKILEAELAVEQKSDQ
SLEGGGSPSDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASF
SHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAI
ILFNPDAKGLSNPGDVEVLREKVYASLESYCKQKYPDQQGRFAKLLLRLPALRSIGLKCL
EHLFFFKLIGDTPIDTFLMEMLEAPHQLS
Download sequence
Identical sequences Q28CI3
ENSXETP00000044055 ENSXETP00000044055 NP_001015937.1.99540 gi|62860048|ref|NP_001015937| gi|89268107|gb|CAJ83850|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]