SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89268137|gb|CAJ83740| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89268137|gb|CAJ83740|
Domain Number 1 Region: 218-232,375-624
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-65
Family Nuclear receptor ligand-binding domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 149-231
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.0000854
Further Details:      
 
Weak hits

Sequence:  gi|89268137|gb|CAJ83740|
Domain Number - Region: 62-142
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00934
Family Ricin B-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89268137|gb|CAJ83740|
Sequence length 636
Comment nuclear receptor subfamily 2, group C, member 1; orphan receptor, TR2-11; nuclear receptor subfamily 2, group H, member 1; developmental orphan receptor 2 [Xenopus tropicalis]
Sequence
MASIEEIAHQIIEQQMGEISRSQPEISQTALMDGTTQRIQLVPSESSVSVPQRIQIVTDP
QTGQKIQIVTALDQSGASKQFILTNNDGSLPSKVILTRQDSSQGKVYLTTPDAAGVNQLF
ISTPDVPAQHIQILSDTQCLDQNLNKQLVELCVVCGDKASGRHYGAVTCEGCKGFFKRSI
RKNLVYTCRGSKDCVINKHYRNRCQYCRLQRCIALGMKQDSVQCERKPIEVSREKSSNCA
ASTEKIYIRKDLRSPLAATTTFVTENKTSRTTSLLDSGMLVNIQQSGVKNESILITPNKV
DACQGDLSTLANVVTSLANLNKSKELPQTNTELSIIESLSNGDSSLSELAQDDQSNSEVT
RAFDTLAKALNQSENSAQGSSECVGSNSNLTDANVEIEGPLLSDAHIAFRLTMPSPMPEY
LNVHYICESASRLLFLSMHWARSIPSFQSLGQENSISLVKACWNELFSLGLAQCCQVMNV
ETILAAFVNHLHNSMQHDKLSADKVKLVMDHIFKLQEFCNSMVKLSVDGYEYAYLKAIAL
FSPDHPGLENVSHIEKLQEKAYMEFQDYVTKTYPEDTYRLSRLLLRLPALRLLNAAITEE
LFFAGLIGNVQIDSIIPYILRMETSDYNSQIIGLTV
Download sequence
Identical sequences Q28CK1
8364.ENSXETP00000051399 NP_001016207.1.99540 XP_012814450.1.99540 XP_012814451.1.99540 gi|114108029|gb|AAI23035| gi|123892381|sp|Q28CK1| gi|62859085|ref|NP_001016207| gi|89268137|gb|CAJ83740|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]