SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89268618|gb|CAJ82769| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89268618|gb|CAJ82769|
Domain Number 1 Region: 96-166
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000615
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|89268618|gb|CAJ82769|
Domain Number - Region: 173-193
Classification Level Classification E-value
Superfamily Elafin-like 0.0994
Family Elafin-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89268618|gb|CAJ82769|
Sequence length 292
Comment novel protein similar to Mespo-MesP-related bHLH factor [Xenopus tropicalis]
Sequence
MDSFSVAHHQQDCTLNQHCATLYPCGYPSSEGYSSLSPASSSDSSGQSPPYMPYIASQEI
FVNIPAAYGQAACQRRGLRHDADKRGKKNTGKLPYSQRQSASEREKLRMRNLSKALQNLR
RYLPPSVAPLDKTLTKIETLQLTISYISHLSAQLGLTEEILTQRRLAETQRTNLCPSGFS
CCMDPTHRLCTTPEEDHFNPAATPTMPFSEARCYPEPGYHGREAVCQQSCETPLQLKQEI
TSPQYADPSTMAKPVRQQCITGLQHTIHCEDYYNLADIWRRDQLQAQMDQTF
Download sequence
Identical sequences Q28IK9
NP_001016653.1.99540 ENSXETP00000057543 ENSXETP00000057543 8364.ENSXETP00000057543 gi|62860226|ref|NP_001016653| gi|89268618|gb|CAJ82769|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]