SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89268696|gb|CAJ82714| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89268696|gb|CAJ82714|
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000236
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 2 Region: 203-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000733
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 3 Region: 99-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 294-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 5 Region: 330-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.00085
Further Details:      
 
Domain Number 6 Region: 251-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 7 Region: 176-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|89268696|gb|CAJ82714|
Sequence length 395
Comment very low density lipoprotein receptor [Xenopus tropicalis]
Sequence
GPASSTPLLPGIVHAIQTPPPPRLLAGTLWIFFKGSRQGVLYNVGRSRAASVPVCIIPSD
RISGGLGAAGCSEMSRSWRGVVLLLLLCCLHPDLGLVHATKTLCEGSQFQCANGHCITSL
WKCDGESDCPNAEDEENCGNITCSPAEFTCSSGRCISSTFVCNGQNDCSDGSDEENCVPP
TCGAHEFQCKNSSCIPLNWVCDDEMNCPSRTCQPDQFKCEDGNCIHGSRQCDGVRDCLDG
TDEIRCKNVNQCSGPGKFKCRSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGG
CSHLCHNLVIGYECDCTAGFKLIDRKTCGDIDECQNPEICSQICVNLKGGYKCECSKGYQ
MDPSTGVCKAVGREPCLIFTNRRDIRKVGLERNFL
Download sequence
Identical sequences Q28IL1
gi|89268696|gb|CAJ82714|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]