SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89271908|gb|CAJ82981| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89271908|gb|CAJ82981|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.95e-30
Family Ubiquitin-related 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89271908|gb|CAJ82981|
Sequence length 77
Comment neural precursor cell expressed, developmentally down-regulated 8 [Xenopus tropicalis]
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
IQGGSVLHLVLALRGGC
Download sequence
Identical sequences A3KNF0 Q28E73
8364.ENSXETP00000015552 NP_001016973.1.99540 XP_018099385.1.7800 XP_018114823.1.7800 gi|126632065|gb|AAI33806| ENSXETP00000015552 gi|115291965|gb|AAI22003| gi|62858961|ref|NP_001016973| gi|89271908|gb|CAJ82981| ENSXETP00000015552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]