SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89273972|gb|CAJ81314| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89273972|gb|CAJ81314|
Domain Number 1 Region: 74-295
Classification Level Classification E-value
Superfamily Kelch motif 7.19e-44
Family Kelch motif 0.0075
Further Details:      
 
Domain Number 2 Region: 242-391
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 6.28e-28
Family Galactose oxidase, central domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89273972|gb|CAJ81314|
Sequence length 429
Comment Novel protein with Kelch motif orthologous to KIAA0265 protein [Xenopus tropicalis]
Sequence
pgprerffraltcsltpvmaaeagggeplvkfvklsgraagskkkvrwfpvrrlfthscp
slripsrflregrrspparsghrcvadntnlyvfggynpdydesggpenedyplfrelwr
yhfatgmwhqmgtdghmprelasmslvlhghnllvfggtgipfgesngndvyvcnvkykr
wsklncrgkkpnriygqamaiihgflyvfggttgyiystdlhrldlstrewiqlkpnnpp
cdlpeeryrheiahdgqriyvlgggtswtayslekihaynfetntwediptkpygnlgfp
aarrchscvqiknevficggynglvilgdlwkldlqtfqwtklpalmpepayfhcaavtp
agcmyihggvvniqqnkrtgslfkiwlvvpsllelcwenllkyfphlcqlpthqllqlgl
sqelierlk
Download sequence
Identical sequences gi|89273972|gb|CAJ81314|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]