SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111306023|gb|AAI21569| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111306023|gb|AAI21569|
Domain Number 1 Region: 468-598
Classification Level Classification E-value
Superfamily TIMP-like 7.38e-35
Family Netrin-like domain (NTR/C345C module) 0.054
Further Details:      
 
Domain Number 2 Region: 278-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 396-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 333-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 5 Region: 101-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000901
Family Galactose-binding domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111306023|gb|AAI21569|
Sequence length 601
Comment netrin 1 [Xenopus (Silurana) tropicalis]
Sequence
MPRILWGFIPFYIISLLCPVPRGQENNSNKASTHGGTPDGPCYDAKQRPKYCIPDFINVA
LGQEVITSNTCGRTPQKLCYFLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDAQTCWKS
ESGITFPQNVTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCR
RVYDQATTSAISKPMQHEATCTDFQTGVKPLTKGLVAFMPLAGRPSARRFEYSPVLQDWV
TATDIRVVFNRLHHGKKMGIRRKTAFYGVSEIQVGGRCKCNGHASRCTAGKEGLMCECQH
NTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVC
LNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVNAMCNQTTGQCQCKTG
VTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRV
HMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRVPIRRGDQPLWVPDHDLA
CDCLRVQVGKSYLIIGNDEESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKCRV
G
Download sequence
Identical sequences Q0V9H1
ENSXETP00000063547 ENSXETP00000063547 NP_001072385.1.99540 gi|111306023|gb|AAI21569| gi|118404128|ref|NP_001072385|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]