SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|112418570|gb|AAI22075| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|112418570|gb|AAI22075|
Domain Number 1 Region: 74-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000102
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 158-196
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000301
Family Hairy Orange domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|112418570|gb|AAI22075|
Sequence length 388
Comment bhlhe40 protein [Xenopus (Silurana) tropicalis]
Sequence
PTFMPLTGIYTPTCSIAKAQTLRLPTTLDCAMERMPSAQPACLDRPPSLSGMDFSHMYPV
FKHRKALKRCEESKQDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAV
VLELTLKHVRSLSSLIEQQQQQILTLQSGSPSEENRISAEEMFHSGFQLCAEEALRFLQG
GERKELVAHLHRVASKLGPASFPKVTEKPVPKVQATNCVPVICRAAPLPSGEQSGTDTDT
DSGYGGEADKGECHHEGTEKEEAPTLERIIKQEKDEIPKKKPRMEATEEETRFCSDLSSL
GVYPAQPPLCLPFYLIPPSASTYLPMLEKYWYPGSVPMIYPPISHSSLLNQDTSKPQHTS
PQTVSPLDSSALLQALKQMPTLGTEPKD
Download sequence
Identical sequences Q0P4H7
gi|112418570|gb|AAI22075|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]