SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114150021|sp|Q3B7I8| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114150021|sp|Q3B7I8|
Domain Number 1 Region: 61-106
Classification Level Classification E-value
Superfamily LysM domain 0.000000235
Family LysM domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114150021|sp|Q3B7I8|
Sequence length 207
Comment RecName: Full=LysM and putative peptidoglycan-binding domain-containing protein 2
Sequence
MADLSPVLQPHREGGSRYGYTMFPGLECESEAELSLSLARTKTRSYGSTASVAAPLSERY
IEHRLSPSDTLQGIALKYGVTMEQIKRANKLFSTDCIFLRKSLNIPVISKKGSLFNGLGS
LDSPENETQDNCNSPTKEPALAEAHTVSIPSSAKTNQPIVRSDEELSAKDFLQRLDLQIK
RSTQAAQRLKEEDLRHDDSYATCSYQH
Download sequence
Identical sequences Q3B7I8
gi|110645648|gb|AAI18886| gi|113205522|ref|NP_001037868| gi|114150021|sp|Q3B7I8| gi|77748410|gb|AAI07590| ENSXETP00000044860 NP_001037868.1.99540 ENSXETP00000044860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]