SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118403542|ref|NP_001072819| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118403542|ref|NP_001072819|
Domain Number 1 Region: 183-447
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-88
Family Eukaryotic proteases 0.00000786
Further Details:      
 
Domain Number 2 Region: 62-125
Classification Level Classification E-value
Superfamily GLA-domain 2.55e-25
Family GLA-domain 0.00029
Further Details:      
 
Domain Number 3 Region: 114-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000299
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 4 Region: 149-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118403542|ref|NP_001072819|
Sequence length 452
Comment coagulation factor 7 (serum prothrombin conversion accelerator) precursor [Xenopus (Silurana) tropicalis]
Sequence
MDPGHKKAFCFCFLMVLSYIPTFAEDASLAQLQDAAGGYRESADVFLQDKRAHSLLNSRK
RRANSFFEEFKAGSLERECIEEICSYEEAREIFQDDRRTKEYWKVYTDGDQCLSNPCMNG
GTCFDQHQSYICTCPMGYEGRHCETNLRDMLKCIYDNGQCEHFCHDNSSTSRQCSCAEGY
KLGADGLSCEPTVNYPCGKIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEIFICGGT
LIAPNWVITAAHCLKPLPENKLTVVLGEHRIGTPEGTEQESKVSKIIMHEHYYGSKTNND
NDIALLKLTTPVNYTDYVVPLCLPEKQFAVQELLSIRYSTVSGWGRLLESGATPELLQRV
QLPRVKTQDCIRQTQMNISQNMFCAGYTDGSKDSCKGDSGGPHATQYKNTHFLTGIVSWG
LGCAKKEKYGVYTRVSRYTEWIKENMDEQPEA
Download sequence
Identical sequences Q0V9B6
NP_001072819.1.99540 gi|111307978|gb|AAI21657| gi|118403542|ref|NP_001072819| gi|163916428|gb|AAI57199|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]