SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024103|gb|AAI35833| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024103|gb|AAI35833|
Domain Number 1 Region: 68-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.64e-51
Family Astacin 0.00015
Further Details:      
 
Domain Number 2 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-32
Family MAM domain 0.0014
Further Details:      
 
Domain Number 3 Region: 425-590
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-30
Family MATH domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|134024103|gb|AAI35833|
Domain Number - Region: 627-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00183
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134024103|gb|AAI35833|
Sequence length 722
Comment LOC100124942 protein [Xenopus (Silurana) tropicalis]
Sequence
MKPMVLPLILLSLHNVIGVPLQDNTEIDVDGGKKLDIFDINEGAGLDLFEGDIILADTNQ
RNSIIGDRYRWPIPVPYFLEDSLEINAKALVLEAFERYRLKTCIDFKPWEGEPNYISVFK
DSGCYSYVGNLRQGKQQLSLGVNCDRIATIQHEFLHALGFWHEQSRADRDDYVTIVWDRI
LPGREHNFNVYDDTRSNSLNVPYDYTSVMHYSKTAFQNGSEPTIVTKIDAFSDVIGQRMD
FSDYDLEKLNRLYNCSSSISFMDSCTFEYNNICGMIQGTGDNSDWNHVLLSAAGPSNDHT
HLGNCKDSGYYMHFSTSTGNAGDKALLESRLFYPKRGFQCLEFFYYYNGNENDALNIWIR
EYTEASPNGTLTFITSIKGNPAEYWQLHHVSLNVKNKFRVVFEGVKGNGPSNGGFAIDDI
NFSEALCPHYIWHIRNFTHESIKENGRIYSPPLYSKDGYAYQVQVRPNGPADSPYDLAIY
FHLISGANDDTLQWPCSLRQAKMELMDQNPDIRKRMSNQRSITTDPTQVASNGDLFWDKP
AKVGTSVTFPNGTQFFRGPGYGTSAFISHDRLHSRDFLKGGDAFFLLSVEDVSHLSASQP
TPVPTTTTKPPVTDIPSPTKPGPDVPKECEGFGCKNDGVCVLENEKPVCRCKVTKDWWYV
GDKCERKVSSQDTLVIAVSSSVTIFAVMLIITLTSVLCLKKKHKKQIAKAGKAQTTENAY
TF
Download sequence
Identical sequences A4II36
gi|134024103|gb|AAI35833| gi|156717624|ref|NP_001096352| NP_001096352.1.99540 ENSXETP00000044365 ENSXETP00000061320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]