SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901778|ref|NP_001090874| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901778|ref|NP_001090874|
Domain Number 1 Region: 402-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-76
Family Eukaryotic proteases 0.000092
Further Details:      
 
Domain Number 2 Region: 22-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-32
Family Spermadhesin, CUB domain 0.0000156
Further Details:      
 
Domain Number 3 Region: 182-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.0000168
Further Details:      
 
Domain Number 4 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 132-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000898
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147901778|ref|NP_001090874|
Sequence length 717
Comment mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) precursor [Xenopus (Silurana) tropicalis]
Sequence
MRIPLLFSFFLWMLSEAEVIQLTDTFGEIRTPNFPDSYPSDSEVTWNITVPEGFRLKLYF
MHFDLEPSYLCEYDYAKVETEDQVIASFCGKESTDTEQAPGKQMITSPGNFLSLTFRSDF
SNEERFTGFDAHYSAIDIDECTEKNDEDLVCDHHCHNYIGGFYCSCRFGYLLHTDNRTCK
VECSDNLFTQRSGLISSPDYPSSYPKSSDCRYRIELEEGFVINLHFDDNFDVEDHPEVTC
PYDYLKIKTGKKEIGPLCGEKSPGRIETGSNSVQILFHSDNSGENGGWRFSYSVSGTPCP
NLRPPINGKLEPSQAEYTFKDQVVISCNQGYRVLKDNVEMESFQIECRKDGTWSNQIPTC
QIVDCKTPKEIENGFITYSTAENRTTFQSSFNYSCREPYYTMVPNITSVYTCDASGEWKN
QETGAKFPTCQPVCGKPTRPLPGIVKRIIGGRNAEPGFFPWQVLIVVEDLSRVPMNKWFG
GGALISDSWILTAAHNLRSQRRDNTVMPVSKEHVTVYLGLHDVRSKMDAVNRTIEKIILH
EMFDPESYNHDIALVKLNEKVIMNQYVMPVCLPELEHELEGPQPNTLGLVAGWGISNPNI
TVDEIISSDMRTHSAILQYVKLPVVLHEVCKESYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFIMQDTDTKRWVAQGLVSWGGPEECGSKQVYGVYTKVSNFVDWVDDKLKS
Download sequence
Identical sequences A4IH11
NP_001090874.1.99540 gi|134023759|gb|AAI35327| gi|147901778|ref|NP_001090874|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]