SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156717668|ref|NP_001096374| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156717668|ref|NP_001096374|
Domain Number 1 Region: 55-200
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000953
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156717668|ref|NP_001096374|
Sequence length 204
Comment uncharacterized protein LOC100124969 [Xenopus (Silurana) tropicalis]
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSAKSFGQGTGTSEAR
AEFRVRYVGSIERLKSEDSNSLQGPLDLINYIDVAQQDGKLPFVPPEEEFIMAVSKYGIK
VATSDQYDVLHRHALYLIVNMVCYDDGLVAGKSLLALKTKDPSQEQCSLWIYQCSSLDQA
QSICKVLSTAFDSVLLEKTQVPAE
Download sequence
Identical sequences A4II94
NP_001096374.1.99540 XP_012818075.1.99540 XP_012818076.1.99540 gi|134023967|gb|AAI35919| gi|156717668|ref|NP_001096374| ENSXETP00000018125 ENSXETP00000018125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]