SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165973400|ref|NP_001107160| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165973400|ref|NP_001107160|
Domain Number 1 Region: 188-387
Classification Level Classification E-value
Superfamily Fibronectin type III 4.02e-24
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 134-181
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000628
Family Elafin-like 0.0014
Further Details:      
 
Domain Number 3 Region: 447-656
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000604
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|165973400|ref|NP_001107160|
Sequence length 683
Comment Kallmann syndrome 1 sequence precursor [Xenopus (Silurana) tropicalis]
Sequence
MWLREPGCRSLLTFILWITLVWGSRCAATATAAAASSRKQDESLSAQSIYRARCTSRCLS
LHITRISAYFKHFQNNGSLIWCQNHKQCSKCLEPCKETWDLRKNNCHNLCEPLFPKKHYE
CLTSCEFLKSVLSVKQGDCPAPEKASGFAAACVESCDADNECSGVKKCCSNGCGHTCQVP
KNLYKGVPLKPRKELTFDEPQPGHLDIKWSSKFNISVEPVIYVVQRRWNYGIHPSEDDAS
NWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSPPPAPTN
LRISNLTTNNEGTVSVRITWDLPEEPDIPVHHYKVFWSWTANRKSVVPAKKKRRKTTEGS
QNSVALDGLQANSNYMVELQAITYWGQVRLKSGKVSLYFSTSPPSTSLDQISKISKMKTD
ILAPPQRKRTARMLEIGAPFYQDNQLQVKVYWKKTEDSMLGLYHVQWFPESCAHNETKGP
EKAVTQDHHIVLPALLFSCKYKVTVHPARPKDHLKAESIFFTTPPCSTLKGKTHKQINCP
SDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQLSKVNLHQPMTGFQVTWAEVTTESR
QNSLPNSIISQSQILPADHYMLTVHNLRPSMLYKLEVQVLTTGGEGPATIKSFRTPDVLP
PLPHRPHLKQHRPNHFKPSPEKY
Download sequence
Identical sequences A9JRI8
NP_001107160.1.99540 gi|161612075|gb|AAI55678| gi|165973400|ref|NP_001107160| gi|213627177|gb|AAI70858|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]