SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166158164|ref|NP_001107287| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166158164|ref|NP_001107287|
Domain Number 1 Region: 1120-1343
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.79e-82
Family Fibrinogen C-terminal domain-like 0.00000113
Further Details:      
 
Domain Number 2 Region: 949-1119
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-23
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 3 Region: 592-757
Classification Level Classification E-value
Superfamily Fibronectin type III 9.48e-22
Family Fibronectin type III 0.0000556
Further Details:      
 
Domain Number 4 Region: 321-493
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-19
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 5 Region: 862-952
Classification Level Classification E-value
Superfamily Fibronectin type III 9.28e-19
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 6 Region: 773-858
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000633
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 7 Region: 500-589
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000103
Family Fibronectin type III 0.0000195
Further Details:      
 
Weak hits

Sequence:  gi|166158164|ref|NP_001107287|
Domain Number - Region: 200-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000321
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 293-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00158
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 231-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0023
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 170-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00342
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 263-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166158164|ref|NP_001107287|
Sequence length 1350
Comment tenascin R (restrictin, janusin) precursor [Xenopus (Silurana) tropicalis]
Sequence
MGSEGVSSALGPLQVGVHLILLACLTRRSQCQSELTGQTPRLDIQVDKGGNMTDHGIENK
QNPMVFNHVYNFNVPLSFPCTLEPETPEDGSWVTQQTENTADAGSQITFTHSIRVPQRLC
QCYTTPHAVQHLLSRIEALEREVMLLRERCNDRACQDAEATGLTEFAPPCSGHGNFTVDS
CICNQGWGGENCSEPLCPLECSGRGTCIEGMCVCEPDYTGEWCTDLLCPEECSPHGLCQD
GQCVCQDPYIGIGCTELRCPGDCLGKGRCANGTCVCQDGYAGEDCGRMWCINACSGRGQC
QDGVCECEEGYSGQDCSEVAPPVDFSVTAVGDHWMDLAWEGTTAVTEYVISYQPAVPGEW
GTQQRLQQRVPGDWSSVTIRELEPGVTYNISVCSVISDIISEPASITISTHISSPRGLNF
MEVTQTSVEVHWDPPVFPLDGWEISFTPKNNEGGLTVQLPSSVTSFNQTGLKPGEEYTVS
IISLKDQARSPATSGSISTDIDGPTNILVRDVTDTVAFVEWTPARAKLDFMQLDYGPING
EGEKTTFRLQPPLSQYSMQVLRPGSQYEISIRGVRGDTESEPVRATFTTELDAPKNLRVI
SHASSTLELEWDNSEAEGEGYRVVYSTLAGDQYHELIVPRNYGQTTKATLTDLIPGTEYG
IGISAIRYNLKSAPATMNARTELDSPTDLMVTGSTDKSISLTWTKARGPIDHYRISFTPS
SGMASEVTVPSDISQYELSELEPGTEYTISIFAERGRQQSKETTIDAFTGFRPITQLHFS
AVTAYSVNVSWTDPSPPPDQFILTYNPIDSKDPLQLFLDPSLRQTRLSALQPSTEYMVTL
LPVHGTVRAELVEGTVTTGVAPPMDLSVINVTENSLAVVWRPPPSSLHHYRLTYQSTKGR
MDSVVIGNDQTRYTLANLMPNTEYKISLRSVRGREESERVGIVSWTAVDPPYGLRTSNIT
ATEALLHWEPPRSEVESYVIIVTHHAGSGETILVDGESIEFQLQNLLPRTNYSVTLSANF
GHQTSRSVGVSFTTILDPPMNLTATEVARTSALISWQPPISPIENYILTYKSANESRKEL
IVDAEDTWIRLEGLLESTEYTVSILSVQNGERSSVTHTVFTTGGRVFSYPQDCAQHMLNG
DNQSGVYYIYINGDMSQSVPVYCDMATDAGGWIVFQRRQNGLTDFFRKWADYRVGFGNLE
DEFWLGLDTLHQVTSQGRYELRIDMRDGQEAVYAYYNKFNIGDARSLYKLRIGDFNGTSG
DSLTYHQGRPFSTKDRDNDVAVTNCASSYKGAWWYKNCHRTNLNGKYGESRHSQGINWYH
WKGHEFSIPFVEMKMRPYNHRTMKKRSLQL
Download sequence
Identical sequences A9JRJ1
gi|161611512|gb|AAI55682| gi|166158164|ref|NP_001107287| NP_001107287.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]