SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166795939|ref|NP_001107675| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166795939|ref|NP_001107675|
Domain Number 1 Region: 29-138
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000887
Further Details:      
 
Domain Number 2 Region: 236-345
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.28e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 404-464
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000667
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166795939|ref|NP_001107675|
Sequence length 476
Comment Wiskott-Aldrich syndrome (eczema-thrombocytopenia) [Xenopus (Silurana) tropicalis]
Sequence
MSRGGPKAAVRQQDNVSSSLLLPQENQKVFQLLGRKCTTLATTVVQLLVAQGGDRWAKQF
LGVLCLVKDNPRRSYYFQLFDLQEEKAVWEQELYEQLRYLPARPYFHTFCSDECQTGLNF
ADEAEAADFQVVVEEKLKKKQHRQDRRQNLPPPPPVSDDRRTSLPLPPPPGPGPFPNGPS
SPQPLAPSQSLNMPAVSIPNPDITSARYRALSAPADKGKNKKGKKKFSKADIGAPSGFKH
VSHVGWDPNSGFDVNQLDPDIRNLFSRAGISDAQLKDAETSKLIYDFIEQQGGVEAVKNE
MRRGETAPPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTAR
SGGPPPPPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTPSGGRGALLDQIRQGTKLN
KLTVSAEPPPSPQPSSEGLVGALMHVMQKRSKAIHSSDDDDDEDGADDDEDDEWDD
Download sequence
Identical sequences B0BMN8
gi|165971387|gb|AAI58508| gi|166795939|ref|NP_001107675|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]