SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170284936|gb|AAI61062| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170284936|gb|AAI61062|
Domain Number 1 Region: 374-759
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-127
Family Oxysterol-binding protein 0.0000318
Further Details:      
 
Domain Number 2 Region: 120-240
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-23
Family Pleckstrin-homology domain (PH domain) 0.000000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170284936|gb|AAI61062|
Sequence length 866
Comment LOC100145444 protein [Xenopus (Silurana) tropicalis]
Sequence
MKEEGPLRRRSCAGVSPGTFLPRPDGRKLVRNASFGGYNELSPALPGFDKGKDEVLQSKE
DTSISMSKSKSESKLYNGSERDIASASSKLTKKESLKVQKKNYREEKKRATKELLSTITD
PSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTPKNGQWVGTVLLNACEIIERPSKK
DGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRAASESDGRCWMDALELALK
CSSLLKRTMIREGKEHDLNSSADNSHVGFYGLLRVNNLHSNENFQLNDSEIERHHFKDQD
TYSDKSDKDNDHDHDESDNDGLGKSEESDSDTSERQDDSFVDPDPPELIKETTYVEEAHE
ELGEAGEASQTETVSEEHKSLIWTLLKQVRPGMDLSKVVLPTFILEPRSFLDKLSDYYYH
ADFLSEAALEENPYSRMKKVVKWYLSGFYKKPKGLKKPYNPILGETFRCLWIHPRTSSKT
FYISEQVSHHPPVSAFYVSNRKDGFCLSGSILAKSKFYGNSLSALLEGEGRLTFLNRGED
YLMTMPYAHCKGILYGTMTLELGGSVTITCEKTSYSATLDFKLKPFLGSDDSVNQISGKI
KLGKEVLATLEGHWDSEVFIHDKKTDVFETFWNPTLEIRHHRLIRCTVNQEEQGEFESER
LWRLVTLAINNKDQTEATQEKFVLEEAQRKAAKERKAKGEEWTCKLFEQDPLTGEWHYKY
ADTRPWDPLNDLIQFENDGVIQTKVRHRTPMVCVPKLKHKASGQQKKGESGCSSPELDNQ
DSSGSEAHLLSHNNRVRKKGADHGELQSAIDSIKKTQEEINRNIIALRNRVSVNTSSTEN
SFLQQRDYFIIFFLITLQIAVSYLFK
Download sequence
Identical sequences B1H2N0
NP_001120370.1.99540 gi|170284936|gb|AAI61062| gi|187607615|ref|NP_001120370|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]