SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170285043|gb|AAI61358| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170285043|gb|AAI61358|
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily Plexin repeat 0.00942
Family Plexin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170285043|gb|AAI61358|
Sequence length 146
Comment LOC100145604 protein [Xenopus (Silurana) tropicalis]
Sequence
MAADTECFLMNNTSCDKCLQNVKCLWCNTDSKCVDYPVKNVLPPSSLCKLRDARWGVCWV
NFEAMIIAMSVVGGSLIFALIICCCCCCRKKKPRNTGLEDEREAREKEQRRTRQEERRAE
MKTRHDEIRKKYGLFKEDNPYSKFES
Download sequence
Identical sequences B1H3D8
gi|170285043|gb|AAI61358| gi|187607221|ref|NP_001120486|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]