SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171846406|gb|AAI61640| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171846406|gb|AAI61640|
Domain Number 1 Region: 151-463
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-100
Family Protein kinases, catalytic subunit 0.0000000000298
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-24
Family Pleckstrin-homology domain (PH domain) 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171846406|gb|AAI61640|
Sequence length 485
Comment akt2 protein [Xenopus (Silurana) tropicalis]
Sequence
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPESTEHSSIPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVAEDEE
EEAMEVKYGSPSDVSSAEQMDVAMSKGRPKVTMNDFDYLKLLGKGTFGKVILVREKSSGR
YYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGL
CKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAQEVMSHRFFASINWQD
VTERKLTPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESDQRPHFPQFSYS
ASIRE
Download sequence
Identical sequences B1WB72
NP_001116936.1.99540 8364.ENSXETP00000037022 gi|171846406|gb|AAI61640| gi|183986695|ref|NP_001116936| ENSXETP00000037022 ENSXETP00000037022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]