SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183986453|gb|AAI66194| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183986453|gb|AAI66194|
Domain Number 1 Region: 539-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-80
Family Protein kinases, catalytic subunit 0.0000235
Further Details:      
 
Domain Number 2 Region: 378-496
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-31
Family Pleckstrin-homology domain (PH domain) 0.0000173
Further Details:      
 
Domain Number 3 Region: 92-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 228-286
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.59e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183986453|gb|AAI66194|
Sequence length 860
Comment prkd1 protein [Xenopus (Silurana) tropicalis]
Sequence
MSAPPVIRPPSPAGTGLSLQIQIGLSREPVLLPEPGELSLGAVREMACSIVDQKFPECGF
YGMYDKILLFRHDPNSENILQLVKSEADIQEGDLIEVVLSASATFEDFQIRPHALFVHSY
RAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLTGLSS
IRTLSVEPLSSAPDEPLLQKSPSESFLGRHSRSGSQLHIGRPIKLDKFFLTKVKVPHTFV
IHSYTRPTVCQHCKKLLKGLFRQGLQCKDCKFNCHKRCASRVPHNCLGEDAINGDLSDVM
MEEGSDDNESRPEDMDESPTTDSEGSISGCRSENGEMQEPDQDQDASDRTISPSASNNIP
LMRVVQSVKHTKRKSSSVMKEGWMVHYTSKDPMRKRHYWRLDSKCITLFQNDTGSKYYKE
IPLSEILSLEPAKDLSLLCPGANPHCFEITTANVVYYVGENLPQPVPPDMGNVMLTSGAG
LDIARMWEIAIQHALMPVNPKGANDGSTQHRDVSISISVSNCQVHENVDISSVYQIFPDE
VLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHQGVVNLEC
MFETPERVFVVMEKLHGDMLEMILSSEKGRLPERITKFLVTQILVALRHLHFKNIVHCDL
KPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNRGYNRSLDMW
SVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISPDAIDLINNLLQVKMRKR
YSVDKTLNHPWLQDYQTWLDLRELECKIGERYITHESDDPRWQQYSEDCRLLYPPHLLPP
PSYEPEDAEMRALEERVSIL
Download sequence
Identical sequences B2GU99
NP_001120884.1.99540 gi|183986453|gb|AAI66194| gi|188528917|ref|NP_001120884|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]