SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189230039|ref|NP_001121513| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189230039|ref|NP_001121513|
Domain Number 1 Region: 118-212
Classification Level Classification E-value
Superfamily EF-hand 1.81e-25
Family Eps15 homology domain (EH domain) 0.0000264
Further Details:      
 
Domain Number 2 Region: 261-363
Classification Level Classification E-value
Superfamily EF-hand 8.52e-25
Family Eps15 homology domain (EH domain) 0.0000797
Further Details:      
 
Domain Number 3 Region: 14-103
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000286
Family Eps15 homology domain (EH domain) 0.00013
Further Details:      
 
Domain Number 4 Region: 385-497
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000152
Family Myosin rod fragments 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|189230039|ref|NP_001121513|
Domain Number - Region: 488-563
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0994
Family HBL-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189230039|ref|NP_001121513|
Sequence length 898
Comment epidermal growth factor receptor pathway substrate 15-like 1 [Xenopus (Silurana) tropicalis]
Sequence
MAALIPLTQLSGGNPFYETYYKQVDPSYIGRVGPAEAALFLKKSALSDIILGKIWDLADP
EGKGYLDKHGFYVALRLVACAQSGHEVSLSSLNVPVPAPKFHDTSSPLLITPPPVEGHWG
VRIEEKSKFDGIFDSLVPVNGLLSGDKVKPVLMNSKLPLDVLGRVWELSDIDKDGHLDRD
EFAVAMHLVYRALEKEPVPSVLPPSLIPPNKRKKTPTFPGAVSVLPSSPPPKDSLRSTPS
HGSMSSLNSAGSLSPKHSSKPAQPAVNWVVPLTDKMRFDDIFLQTDLDMDGFVSGLEVKD
IFMQSGLSQNILAHIWALADTRQTGKLNKDQFALAMYFIQLKVSKGIDPPQVLSPDMIPP
SERNTPIQDSSSSVGSGEFTGVKELDEISQEIAQLQREKYALEQDIREKEEAIRQKSTEV
QDLQNDLDRETSTLQELEAQKQDAQDRLDEMDQQKAKLKDMLNDVRQKCQEEGQMISSLK
IQIQSQESDVKAQEEELNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQEEIN
QARSKLSQLQESQQELNQNSDQYNDALNGDHGSSMNNLSDTESFSSRERTDHSSTIEDPF
KNKSHLFSNNNQDIYSDPFQTEDPFTSDPFKGADPFKSNPFGDDPFKESDPFHAPTSEDP
FQKPAKGDPFSADPFTKNSVHSMTLPLKSDPFESSDPFISSTLPKKKTDPFGTLDPFGSS
AFSSNESFADFSHMSKQHQAPDPFSATFPGTGFSDDPFKSKHDTPALPPKRSVPPRPKPP
SGKSTPVSQLSTSHFQKSHDPFQPFGTEPGDPFQSRKSFTDPFSGKDPFATSQSGKHSKG
TSAGFANFGSFGNEEQQLAWAKRESQRAEKERLDRLKRQEQEDLELAIALSKAEMPSS
Download sequence
Identical sequences B2GUP4
NP_001121513.1.99540 ENSXETP00000004450 gi|183985776|gb|AAI66356| gi|189230039|ref|NP_001121513|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]