SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189442665|gb|AAI67455| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189442665|gb|AAI67455|
Domain Number 1 Region: 33-159
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.01e-57
Family N-terminal domain of cbl (N-cbl) 0.000000345
Further Details:      
 
Domain Number 2 Region: 246-332
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-48
Family SH2 domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 338-416
Classification Level Classification E-value
Superfamily RING/U-box 7.49e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 161-245
Classification Level Classification E-value
Superfamily EF-hand 1.36e-36
Family EF-hand modules in multidomain proteins 0.00000713
Further Details:      
 
Domain Number 5 Region: 840-875
Classification Level Classification E-value
Superfamily UBA-like 0.000036
Family UBA domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189442665|gb|AAI67455|
Sequence length 888
Comment cbl protein [Xenopus (Silurana) tropicalis]
Sequence
MATNLRKGGGLIGLVKDAFQPHHHHPTAQPGAVDRKTVEKCWKLMDKVVRLCQNQRLALK
NSPPYILDLLPDTYQHLRTIMSRYEGKMEILGENEYFRVFMENLLKKTKQTISLFKEGKE
RMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGQFQGDSFRITKADAAEFWRKAFGEKT
IVPWKIFRLALHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNW
NSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTI
PHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTF
QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRG
GGMAELLRHCMDGTPSPCYDDDDDDSGNDSIFVMKELAGAKVERPPSPLSATPQASLPPV
PPRLDLLPQRAPNQSGACSPATSSKASSSSHHKDKPLPVPPTLRDLPPPPPPDRPHSMPC
ESRPQRRPLPSTPAEKPLPLPTNRPGETWHPRAVPKAPASNLTPGDPWTGGRELTNRHSL
PFTLPSHIDERRDRHGSTQSLDNTGISATTELFGGLDNDDAKMKPSSSANAIYSLATRPF
PVSKPPTGDHVDSGDESEYMCPSSRPLIPAAVPKSEARRPLETLPGLRPPDQQTERESYE
TMYNIQCQATNPVVVEPSREEETNSAIANNGPENDDNEEDGYDIPKPHLPMAPARRTMSD
APNATPAFCSGAIGRDSGAGLLESSQVPERPPKPFPRRMNSERRSVVGGGSGDAPPAPLS
SEIESLLSQGYSQQDVNKALLIAHNNIEMARNILREFVSIPSPAHVAT
Download sequence
Identical sequences B3DLI0
8364.ENSXETP00000046653 gi|189442665|gb|AAI67455| gi|191961816|ref|NP_001122110| NP_001122110.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]