SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213625703|gb|AAI71157| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213625703|gb|AAI71157|
Domain Number 1 Region: 28-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000118
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|213625703|gb|AAI71157|
Sequence length 259
Comment hypothetical protein LOC100135189 [Xenopus (Silurana) tropicalis]
Sequence
MQPATASVLDLSRNVPVTEGRDNLYRAGQCKKMSPPESGTLHIVYGNGSSVGTVLMFQCS
SMYQLVGEGISTCVWRGNSTLWTSGAPTCKAISRYETFGFKVAVIASIVSCAIILLMSMA
FLTCCLVSCVKKNERRRSEREKVVWHQLDCEGLENVPAEQFGMKGRNNNNNKDGSRPALA
EWISMAYENHGFCRCHDVWAGEVPAAAFGGECSGSGPKPASRGAPSCSVAIQTVSGGHII
EVYGRDKEFMRRFEAQLPE
Download sequence
Identical sequences A9ULD6
NP_001107364.1.99540 ENSXETP00000059170 gi|163916033|gb|AAI57216| gi|166157909|ref|NP_001107364| gi|213625689|gb|AAI71131| gi|213625703|gb|AAI71157| ENSXETP00000059170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]