SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213627173|gb|AAI70852| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213627173|gb|AAI70852|
Domain Number 1 Region: 178-300
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.96e-59
Family Dystroglycan, domain 2 0.000000679
Further Details:      
 
Domain Number 2 Region: 484-585
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000675
Family Dystroglycan, N-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 61-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000345
Family Dystroglycan, N-terminal domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|213627173|gb|AAI70852|
Sequence length 885
Comment dystroglycan 1 (dystrophin-associated glycoprotein 1) [Xenopus (Silurana) tropicalis]
Sequence
MDIRCAALSLPMLRTIMVLLMASSAWSVWPSDPMEVVQDWDNQLEASMHSLFPEIKEAVA
PMTGIPDSSAVVGRPFKIHIPTEFLASSGETIKIFEVGKEILPSWLHWEANFLQGLPLDG
DKGVYDISVASMRLAPNGSYVTQTADVFAVEVHPEDHNEPQSVRVAGQETAEATPFLCGT
DEPVTILTVILDADLTKMTPKQRVDLLNRMRDFSEVELYHMKLVPVVNNRLFDMSAFMAG
PGNAKKVVENGALLSWKLGCGMDQNTVPNISSVEVPAKEGTMSAQLGYPVVGWHIANKKP
QMPKRIRRQIYATPTPVTAIGPPTTAIHEPPERIVPTPTSPAIAPPTDTTAPPVREPIPL
PGKPTVTIRTRGAIIHTPTLGPIHPTRIIETTSIVRPTITRHIFVEPTAAVTPPSTTTKR
PRTTMKPPTPPTTDSSTTTTKKPTKKPRPRPPKPLATTKAPSTKVETTSPSRTRPSTSGV
PNTDPELKNHIDKVVAWVGTYFEVKIPPDTFYDKEDGTTDNLQLSLAPRQKAGLGEKMWV
MLNSTSQVMYGMPDYTHIGDHEYYLRAADKAGRTAVDALEIQVRNLFQKQPSTVKFHAKF
HGDHNAVINDINKKILLVKKLAFAFGDRNSSSITLHNITKGSVVVDWTNNTFPVEPCPVE
QVEGVGKKIYDERGSPRQHFVNAVEPEFKLLNISLSFSGSCKHKKFRYIPMRAEEPIPTA
VAPTVAVDRNLEKRSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTIEDQAT
FIKKGVPIIFADELDDSKPPPSSSMPLILKEEKAPLPPPEYPNQNVPETIPLNQDSLGEY
TPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences B7ZTF0
gi|213625554|gb|AAI70850| gi|213627173|gb|AAI70852| gi|62858083|ref|NP_001016518| NP_001016518.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]