SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218931150|ref|NP_001116263| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218931150|ref|NP_001116263|
Domain Number 1 Region: 434-558
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 320-451
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000118
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 43-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000606
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 290-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 258-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000084
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218931150|ref|NP_001116263|
Sequence length 678
Comment delta/notch-like EGF repeat containing precursor [Xenopus (Silurana) tropicalis]
Sequence
MPPPYSLAALSALVLLLSGILVCAELSGEPCGAEPCESGGTKFATDPCSENPCNHGNCSL
LGNGYLCICSDGFTGLNCDQAPLHSAEIVTPSHTEPIHSTTGPRIEVAHSPAAQELPTWR
PRVGQKVTTLKWDEVQIIPDVACGNASSNTSSGGRLVSFEVAENTSVKISQDATAALILL
WKVTASGFKQCSLIDGRSVTLLQALGGLVLPDEVLALGNNYFIGFVNDSVSKSIVALRLS
VVVKITDCVPEGSLPDALQCHGKGDCLTKTTEDTYSCHCEAGYIGSYCEEFDACHLHPCL
NNASCTDIPQRHHGKNATCTCLPGYTGEHCEALVDHCSPQPCRNGATCTTSLSGFSCHCP
EGFLGSFCEEKVDPCAASPCLNNGSCTSAGISYSCRCSPGYTGPTCAQLVDFCALSPCAH
GICRSIGTSYKCLCIPGYHGLYCEEEYNECLSNPCQNGATCKDLVNGYQCVCPVEYEGLH
CELYKDPCVNVSCQNGGTCDSEGMNATCVCVPGFIGEECEIDVNECDSNPCHHASTCVDQ
VNGYTCHCPHGWVGATCEIHLQWKAGHMAESLTNMPRHSLYIIIGALCVAFVLMLIILIV
GICRISRIEYQGSSRPAYEEFYNCRSIDSEFSSAIASIRHARFGKKSRPAMYDATPVSYE
DYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences B1H2I7
NP_001116263.1.99540 gi|170285101|gb|AAI61016| gi|218931150|ref|NP_001116263|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]