SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301603716|gb|XP_002931515| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301603716|gb|XP_002931515|
Domain Number 1 Region: 188-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-28
Family Clostridium neurotoxins, the second last domain 0.012
Further Details:      
 
Domain Number 2 Region: 603-751
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000269
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 3 Region: 1417-1489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000222
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 4 Region: 465-561,642-698
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000267
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 5 Region: 1483-1538
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000131
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 6 Region: 1361-1423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00005
Family Complement control module/SCR domain 0.0068
Further Details:      
 
Weak hits

Sequence:  gi|301603716|gb|XP_002931515|
Domain Number - Region: 759-802,986-1030
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000295
Family Fibronectin type III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301603716|gb|XP_002931515|
Sequence length 1688
Comment PREDICTED: pappalysin-2-like [Xenopus (Silurana) tropicalis]
Sequence
mellglyvwsvcllccwarpqrddpihrhkqelrvredhlrqqslkepcrlgrntrsqyd
pqyshfkaypaqkhhskaekgklrshqhgsntfengqvkkekvsvntsasqktlqgyrps
nqivlngkvskmvngsysqnqkykrtirqiaqtaakkrnprhtainvseeimsdylmpid
lsqdqsihgsmyfpgvhsqlvlrpdvelqiprekftvemwvmpeggqndpaviasmfdnc
shvvsdrgwslgirpvvpgskrdahfyftirtdrsqnvttllssfrykpsvwthlaatyd
ghmvslyvdgilisrsygqvgslhspyislcrslmlggdnsqsgncfrghifslrlwsep
rtqkqlrdaaqgeseifpnnhfltfppenmwasykegifpeinmdltpeidmmsppllpp
cgrtlcdlpdviagysrpgvnwekevryrvvnlcdddgsrplvsaeqicrqhqalsdays
plgikwqlnvqeihnsslrnravlpgcepgrvgnehcdpecrhpltgfdggdcglyrpcn
prkrgdgvchpecntarddyddgdccptqesgrsskncfdpdaqgraymsvkelkdmlql
nntlylnvyfassggeglagsatwpwdkealghqgglvlnpsyygmsghvntmihevgha
lglyhvfkgvserescddpcsetepsmetgdlcedtaptpkntfcrdpdpqndtcgptfy
tgtpfnnymsytdddcansftpnqvarmhcyldlkyqewtksqrpspvplppvvikqsld
sltihwlpplsgklyerdststcescssdgsfyqyayhasspricdssgywtpeeavgpp
dvdqpcepslqawspelhlyhtnmtvpcpqpngcmlelhfqhpvlpqsitiwitylspnv
vrsvsdlevllehgetidlgmmeafcdmpltvrltpdqkvtgvriytfdermeidaalli
stphnplcsvctpirykvlrdppfqrdhhgiwtqnqnsftdievipgqryqyqvqvaagt
lvgepspplthlhgapfcgdgvinteqgeecddrglndgdgcshkcqqepnyscrgepsl
cyiqfedsanilydnllisrssgwpaiqeyvdqwasqattshqdphkcpvsaitrepvlk
tcharnfeplfwthsawfpctaannmsleqhvwlkvnfdnprsahsfhvylaadgslpeg
tqrptvtahitdimgqnqslgtfelsckrnplilsgshsgnsplysavsltlnfssplag
iygvmmrsladlhhpemwmdqaqdgvgsssctplniahgsthcsleeneqlhcsvicneg
hvvhavskgrnsvmqvavlgcfaghwnmsvtcipqdcgppapslvfnatfscpegttlgk
hcffhclppakfqgishwvtcmwdglwslpngyckleceapeviphsrlltsrclhgnhd
vgsvcryrckpgyhvaehterrtrrkflkihclqtglwaegrcipvmcdplppilqglyn
cskglevdskctlycgshtvstvcskdgswteklslceglqgtcipppemnhiqytcdng
hsigsvctasciyplsdavvlpenitadtmehwmipakvqgimctgilkwhpepfalhci
pscepfladgwcdtinnraycqydggdccastlsshkvipfaadceedectcrdpdaeen
rihrpeah
Download sequence
Identical sequences gi|301603716|gb|XP_002931515| XP_002931515.3.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]