SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605140|gb|XP_002932192| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605140|gb|XP_002932192|
Domain Number 1 Region: 873-935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000513
Family Complement control module/SCR domain 0.0081
Further Details:      
 
Domain Number 2 Region: 86-152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000089
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 3 Region: 638-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000288
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 4 Region: 690-751
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000157
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 5 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 816-875
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000031
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 148-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000499
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 502-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000236
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 9 Region: 747-810
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000262
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 1125-1186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000773
Family Complement control module/SCR domain 0.0068
Further Details:      
 
Domain Number 11 Region: 1191-1252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000809
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 12 Region: 1067-1125
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000983
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 13 Region: 999-1067
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000038
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Domain Number 14 Region: 579-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000126
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 15 Region: 271-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000127
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 16 Region: 457-511
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000721
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 17 Region: 24-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000119
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 18 Region: 940-995
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000216
Family Complement control module/SCR domain 0.0082
Further Details:      
 
Weak hits

Sequence:  gi|301605140|gb|XP_002932192|
Domain Number - Region: 324-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00192
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number - Region: 399-451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0202
Family Complement control module/SCR domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301605140|gb|XP_002932192|
Sequence length 1288
Comment PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
msltgylqvyitalcciaigaqapcgrpertaeeelqgtwdkdsyddgtiasyicrpgys
rlgaikkqckngiwiylargqcrkkscghpgdipngsfeldgenefvfgatviyncdsgy
hmvskvttrtctangwsnflpncevkncppveptegveivssyddeytvgkvmrfqcknp
kfklngvaeifctsegdwnapppeceeikcsapvlangrinnqketyylddklfyvcnek
ykkersldpvctkngwapeptcneitcmadnvsngniknkkiiyrlgdtieveckqgysl
dkpdeprkctvngwsppltcmdkicdrpsiqngwlhsgtrfparknadlwyvcyddfeav
nreysywerryygkskctengwhpmpkclalcsrsaaqvdnayvdhtgnqykegervrfq
cyrdtrtedgrtygdieclpnhkfsearclkscmiesvshgtyipkksmfehgeflvyec
degyrstkntrfdsatcpwtslprcvettchiaelneeykagdviqfscshgyelvgqev
sqcyyygwdpelptcrdnihrqrsryelvtkrqvdlsvcapapkppqsqdseignityhn
dstveircasqyralgsksikcqngkwqsppqcigmrhckqppridngkfitekewhssg
dvvtyqcdegyeisgsseswcflgqwtgtpvckgkscdqppdvenafvnglqqqykhgas
akyscqagytiseddqakcvegkwrhipkctstscesapeisnamllnkknnynsgdraf
frcntgyvfnkdqnsaicknsqwqelpecrkqgqicelppvvqfgdtlqnrepnnkhgtv
mtykcpeyyklegnkevvcrngkwddppiciepctasesdmkanniqlkwlsdkklysrh
dewigfsclygyeisdekllriqcnrsvlpypkctkigscllslmtmeennifvngstei
ehgktvtfmckegcistdtltqecknknlmypkctraapceisseelsqnnldlkssdnp
tktfyahkqeilvtckpgfrssekkplkaecwngtitfpkcspgnnctfperinknviie
aqdgrsfssgstlkfeckegfaavgppfitcdnsmwttptcarkclvsipeletnnlqle
ltndldgtftsgnklnvqckpgyiseqkahlkatcrngnfiypqcspgsscaisindlge
nkvdllrpndtnkeyphgtqfqfkckasyvlppqkqlqalcdngnvnyprcysikrcris
qeqvdenglqleskyedsvyfedgelsg
Download sequence
Identical sequences gi|301605140|gb|XP_002932192|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]