SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605719|gb|XP_002932473| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605719|gb|XP_002932473|
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.59e-30
Family Hormone receptor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 126-410
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000065
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301605719|gb|XP_002932473|
Sequence length 421
Comment PREDICTED: glucagon receptor-like [Xenopus (Silurana) tropicalis]
Sequence
mrlvlllplltisqkaasqvlertveewmryrdecykrmastphpsglhcnrtfdmyacw
pdgtpgtityvpcpyylpwfqkvshgllsqrcgkdglwvkgnrsqawrnvsqceddtevt
aeevetrdlllsfralytvgysvslltlisalliltmcrklrctrnsihanlfasfalra
vsvivkdvllakrwgmqitevsdwevlisdqaaigcriaqvvmqycilanhywfvveavy
lyklligavfseknyytlylylgwgtpvlfvvpwvtlkylkensecwalnenmaywwiir
ipillaslinlvifmrilkvilsklranqkgyadyklrlakatltliplfgihevvfifa
tdeqtsgilryikvffnlflnsfqgflvavlycfankevkseihkkwrlwqadrkalvcp
r
Download sequence
Identical sequences gi|301605719|gb|XP_002932473| XP_012826424.1.99540 XP_012826426.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]