SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301606681|gb|XP_002932945| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301606681|gb|XP_002932945|
Domain Number 1 Region: 3695-3837
Classification Level Classification E-value
Superfamily SET domain 5.89e-46
Family Histone lysine methyltransferases 0.0049
Further Details:      
 
Domain Number 2 Region: 1413-1482
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000113
Family PHD domain 0.0069
Further Details:      
 
Domain Number 3 Region: 1511-1579
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000221
Family PHD domain 0.009
Further Details:      
 
Domain Number 4 Region: 1650-1713
Classification Level Classification E-value
Superfamily Bromodomain 0.0000209
Family Bromodomain 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|301606681|gb|XP_002932945|
Domain Number - Region: 1376-1434
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00117
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301606681|gb|XP_002932945|
Sequence length 3840
Comment PREDICTED: histone-lysine N-methyltransferase MLL isoform 2 [Xenopus (Silurana) tropicalis]
Sequence
mahscrwrfparpgtgrrlgarhrlsailiddvseyrsnpgasgsagassagtlapggpg
nclgvalgfdaalqvsaaignnlrrfrdvsggssgeeeqflgfgsdeevkgrspakspkd
qttqrkprgrprnslsrcsdassnlcenttstlnkqetrlldkvkkpeskteekkrgrpp
ahgnvkfklpqekrdgtesikapceekskrrkpsatfqhaakikklragklsplkskfks
nklklgrkggvsivrrrgrppsserfktdthgsfpkqvptdrsqrgnkdvspqpskedtr
vsvrqsprrmkpvriipsskrtdtaiakqllqkakkgaqkkmeleaaklqgrkggtqlkn
irqfimpvvstvssriiktprrfiededyeppikiarlesapngsrfstascgssekssa
asqqssqatsddsrssspsvdtstesqaseetpvvsepqgrvaetitsvptqqqplesng
vrtrrlpvcnknfssrpakkivlrpsfqqkssvsppppllspptplqpsaslpdhtpwlm
paipmatpfisasrmhekrrsilreptfrwtslkhsrlesqyfssakyakeglirkpifd
nfrpppltpedvglatasgfpshtvvgpgrlfshihssgarfdvhkrspllraprftpse
ahsrifesvtlppsagrasgtssmmgisrrskrrvfnpirssepkspshsmrtrsrrvgn
sslsvlasppsssltdisvsplatsalnpsfpfssssvtpasvdiaekiqkprkptstpa
ehftsspssspalfpwfpssvqmekgksknrgsvesskereveknrekdrekensrdsrr
dkrkkssdsgckisrerndeegivtatqikmsvrkkpvtvesnvdispasihtdqipakn
kiskkgrpvsekteldtcaksptaetqaqlpaqpvsalkhpstsissmlaqadkfpvsdk
hvatllrkakaqlckiekskflkqtdqpkaqgqesdsseasvrgprikhvcrraavalgr
kravfpddmptlsalpweerekvlssmgnddkssiagsedadqpapplkpikqitrnkaq
qeppvkkgrrsrrcgqcpgcqvpddcgictncldkpkfggrnikkqcckmrkcqnlqwmp
skaylqkqakaakkkerkckvtekkelppvkspselivkpvsapgtssppvqeepatpsl
pqkkneppkkqteekseeqipaastsetkqspnsrkttkqppsqpsttiamtpltatpst
kkeapkpippesrkkqppvlpdntsteqnkqkklamrlgallkskgkekdkpqppskpev
sfnllntlcnggitkqkppsdgvhrirvdfkhdcevenvwdmggisllttapvtprvvcf
lcassghvefvycqvccepfhrfcleererpsedqienwccrhckfchvcgrqqqatkql
lecnkcrnsyhpeclgpnyptkptkkkrvwictkcvrckscgsttpgkgwdaqwshdfsl
chdcaklfakgnfcplcnkcyddddyeskmmqcgkcdrwvhskcenltdemyeilsnlpe
svaytcincterhpaewrmaltnelqaslryvltallnsrtsshllrcrqaakppdlnpe
pdenmpsrssaegpdppiltqvgkqdeqppldlegvkrkmdhgkyksvlemsddivriiq
aamnadggqpelkkansmvksfftrqmervfpwfsvkksrfwepnkvtsnssmlpnavlp
psldhnyaqwqerenrlamqpvlmkkiipapkprspgdpespqpvqpstppapttelnre
espelppppglednrqcalclkygddnanvsikhfffftqtsqstgsltncfpislkvti
dkqgslehlhlnfpvitgkaslrcelclklgatvgccltsctsnyhfmcsrkkncvfled
kkvycqkhkdlikgeivsdngfevlrrvfvdfegitlrrkflnglepdnihimigsmtid
clgilsdlsdceqklfpigyqcsrvywsttdarkrcvytckilecrpppadpdinstvqh
eenrtiahspqslhsdvqenqstdgikcietlclsspdsvsaasvtkpwevgrpsgcrth
ipryspsqrspgsrplpsagspspvtheivtvgdpllssglrkigsrrhsssslspqqhk
kifsphpqtdisrfgqplqgipvnslensgngdpvcigastissksscspntgqkaieck
lekapearrtgfletpskvstpktekvktasprvsdpssehpspkvpsqvqemtadaskn
kagclkdsspallnfktssnmqhqkvirrdndrqsvvtqgetpslekgknsqilasnhgi
svhkdrrvktkrsmldnskdkhsskppsdnehapdnrqnepdtngnhmlsdtlsfrahll
kksidngisspgnsqseetlvsagklpqtkmgidggcnieiakqttssanqsaeladnek
hkcvsdgtgdvpvsqtnsnadsepqtgsaypiqesslvhqdgsktqedgsykrryprrsa
rarsnmffgltplygvrsygeedlpfcsstpgkkrgkraaegqvdgaddistsddddvyy
ynfsrtvvtpgderlgihtlfrqddqrdlhkipqldgvddeaecntsvtvtkssqagkrs
gkqngagklqtpegqlekshvgkgqktsepkienchavkqdtleaqlaldtprrahsgse
knlldtfnsdllksdsdnnnsddcgnilpsdimdfvlkntpsmqalgespesssselltl
gdglgldnnrgkemglfevfsqqlptsepvdgavpttisgeeqfelplelpsdlsvlttr
spalpsqnhsrlgvitdsqlstsgersllaittssdtvekrvtvteksgtpgdgdssllg
qnldraseghitpdrfitghidqehissptcgqvdhtgreerarnsstpnlqvsvspsvs
iqnqkyipsssespgtsqipsntiqstpqhlkspaeklvvvnqnmqplyvlqtlpngvtq
kiqlapsvptsssrtegevpvlspmgggltlatalnptltstfpsaskgilpmshhphlq
pfpggpqttflpnlnnqssglligvqpssepsllvsetgqrsdvgstsntsapgmnkkrq
itrlhtrknkklapsvspasrhapdvvsnmtlinfapsqitgaltshtglidlgtignta
phrnipsiiktsksgvmyfdqtpllpqnvgtsssmgtapsvigldtghlpgqvtslatgs
pvlnvvsmqpasaappvsghvtltspgilnpselnsisnfliktspqglgiqdnhvtlps
gpgmfsqcstsatiattssicvvpssqsvgmtlsqpindpdchypishhmnrllnsrpqi
lpesssetnarapalqmlaesetkltvptsalglqrnpvavpqktkskakrqtapadkts
rkkqktlhlapnpptvqeserhdkpaasdhtgaheekvntselmvpsmkntaepplpagq
laiisdpepllkelcqqdpkhddskqreedtgfssplmrllqqernrqgspteekpktgl
lfeissddgfqisagsieeawksltekvqearsnarlkqlsfagvsglrmlgivhdavvf
lveqlyganrcrnykfrfhrpegeeeppinphgsaraevhrrksafdmfnflaskhrqpp
eykpndeeeeevqlksarratsmdlpmpmrfrhlkktskeavgvyrspihgrglfcrrni
dagemvieysgnvirsiltdkrekyydgkgigcymfriddsevvdatmhgnaarfinhsc
epncysrvipidgqkhivifamrkiyrgeeltydykfpiedannklacncgtkkcrkfln
Download sequence
Identical sequences gi|301606681|gb|XP_002932945|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]