SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301607900|gb|XP_002933538| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301607900|gb|XP_002933538|
Domain Number 1 Region: 679-824
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-44
Family Toll/Interleukin receptor TIR domain 0.000000337
Further Details:      
 
Domain Number 2 Region: 112-252,466-599
Classification Level Classification E-value
Superfamily L domain-like 4.31e-34
Family Ngr ectodomain-like 0.067
Further Details:      
 
Weak hits

Sequence:  gi|301607900|gb|XP_002933538|
Domain Number - Region: 252-452
Classification Level Classification E-value
Superfamily L domain-like 0.0408
Family Internalin LRR domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301607900|gb|XP_002933538|
Sequence length 831
Comment PREDICTED: toll-like receptor 2 type-2-like [Xenopus (Silurana) tropicalis]
Sequence
mrgleernervrreeresykrgtrelqernervtreewvlekysttwalpinpnktkmvf
qkknskqsqtpsfllnnralshtdrcfstsvmyiysiciiyllaiaelskgntdcpcdaa
hfchcssmhweaipsglprdvrglnlssnaiqivtetdlkpydqlqtlllqynaihtind
gsfqplgnleeldlsynnlvllssvwfrnlnklkhlnllgnqyitlgndslfaslsslss
lqfgnqnfdaiqkqsfeglerlntleinaaqltlyeegslgrmkqiyhtilrvnltllpa
llkdlvhsvtlleitdtefstpadmqafevlaytsvkqfifrnctivdvsgyrfveiiqt
yrnitdvvmkncrllgrgldcpnlkrttssvttiiinnievslyyifsdlsslhqiipqf
tyvtvtdspvylipcqfsqsftslqyldvsggkldntylgssvcyhegggacpklqtlnv
srnlltsvpkvaqflsglnyltnldisqnkfselstskcqwpknlkylnisnnqiniitt
cipptlqildvssnyltvfaiempnltelyisnnrlsklpegmyftslvllsisrndlng
fgqsdlelfsnlkdvqiqdanlpplvchktlivtlscillialvaaivalchflhvvwya
kmtwawlkakrkplkncdreicfdgfvsyserdsewvenmmvpklenatlamklclhkrd
fvpgkwiidniidameksyktvfvlsehfvrsewckyelefshfrlfdenndsaililld
pieketvpkrfcklrklmntktylewptdeeqqevfwdnlktalqpadyin
Download sequence
Identical sequences gi|301607900|gb|XP_002933538|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]